KEGG   Shewanella sediminis: Ssed_1629Help
Entry
Ssed_1629         CDS       T00596                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sse  Shewanella sediminis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssed_1629
   01212 Fatty acid metabolism
    Ssed_1629
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ssed_1629
   00650 Butanoate metabolism
    Ssed_1629
  Lipid metabolism
   00071 Fatty acid degradation
    Ssed_1629
   01040 Biosynthesis of unsaturated fatty acids
    Ssed_1629
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ssed_1629
   00310 Lysine degradation
    Ssed_1629
   00380 Tryptophan metabolism
    Ssed_1629
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ssed_1629
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ssed_1629
   00281 Geraniol degradation
    Ssed_1629
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ssed_1629
   00930 Caprolactam degradation
    Ssed_1629
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Ssed_1629
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Ssed_1629
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Ssed_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1944090..1946237
Genome map
AA seq 715 aa AA seqDB search
MEKTFNLARREDGIAILTMDVPGETMNTLRAEFGPEINQVLAEIKADSSIKGLVLISGKK
DSFVAGADISMLDACKTAADAKQLSQQGHVVFNELESLKIPVIAAINGACLGGGLELALA
CHQRVCSLNSKTMMGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQLRPKQALKM
GLVDDVVPESILLETAVEMALKGKRAPKKVKKSLVTRLLEGTPPGRNIIFDQAGKQVEKK
THGNYPAPAKIIDCVRQGMAKGLTKGLEVEANHFADLVVSKESEALRSIFFGTTEMKKET
GAGDVEPRKVHKAMVLGGGLMGGGIASVTTTKAKIPARVKDISEQGLSNALSYAYKLLDK
GVKRRHMTPAVRDNLMSLMTTTTEYKGIKDADIVVEAVFEDLKLKHQMVKDVERECGENT
IFASNTSSLPISQIAEAASRPENVIGLHYFSPVEKMPLVEVIAHEKTSAETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPMTLLDE
VGIDVGAKISPILESELGERFKAPAAFDKLLADDRKGRKNGKGFYLYGSKAKQRFKKKAK
LVDESVYAVLGLTPTSTDSNNDSQDVAQRCVVQMLNEAVRCLEEGIIASPRDGDIGAIFG
IGFPPFLGGPFHYIDSMGAAELVAVLETYQAKFGDRFTPCDRLKEMAENGLSFFE
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacctttaatttagcgcgtcgtgaagatggtattgccatactgacaatggat
gtgcccggcgaaacaatgaacaccttgcgtgccgagtttggccctgaaattaaccaagta
ttagcagagataaaagccgacagcagtatcaaagggctggtacttatctccggaaagaaa
gactctttcgttgccggcgccgatatctctatgctggatgcctgtaaaacggccgccgat
gctaagcagttatctcagcagggacacgttgtctttaatgagctggaatcgttaaaaatt
ccggtcattgccgctattaatggcgcgtgtctaggtggtggactcgaattggcattagcc
tgtcatcaacgagtatgtagcttaaacagtaagaccatgatgggcgtgcctgaggtacaa
ctcggcctgttacccggtggtggaggaacgcagagattaccacgattagtcgggatcacc
accgctctggatatgatgttgacgggtaagcaacttcgtcccaagcaagcgcttaaaatg
ggattagttgacgatgtggttcccgagtctattttgcttgagaccgcggtagagatggca
cttaaggggaagcgtgcccctaaaaaagtgaaaaagtcattagtgacccgcctgcttgag
ggaactccgcccggccgcaacattatcttcgaccaagccggtaagcaagttgagaagaaa
actcacggtaactatccggccccggcaaaaattattgattgtgtacgtcaaggcatggcc
aaagggctaaccaaagggttggaggttgaggctaaccactttgccgatctggtcgtctct
aaagaatctgaagcgctgcgaagcatcttctttggtaccactgagatgaagaaagagact
ggcgccggtgatgttgaaccacggaaagttcataaggctatggtgttaggtggcgggctt
atgggaggaggtatcgcgtctgtgacgacgaccaaagctaaaatacccgctcgagtaaag
gatattagtgagcaggggctgagtaacgcgctttcttatgcttataagctattagataag
ggcgttaagcgtcgtcatatgacaccggcagtaagagataacttaatgtctctgatgacg
acaacgacagaatataaaggcattaaagatgccgatatcgtcgttgaagccgtgtttgaa
gatctgaaattaaagcatcagatggttaaagatgttgaacgtgaatgtggtgagaatacc
atttttgcctctaacacctcctcactgcctatttcgcagatagccgaggccgccagccgt
cctgaaaatgttattggcttacactacttttctccggtcgagaagatgcctttggttgag
gttatcgcccatgagaagacctctgccgaaacgatagccacaaccgtcgccttcgcccgt
aagcaggggaagacgcctatcgtggttcaagatggggctggtttctatgtcaaccgtatc
ttggccctgtatatgaatgaagccgctcaactgctgctggaagggcagagtgttgaacac
ttagataaggcgctggttaaatttggtttccctgtcggacctatgacgctactcgacgaa
gttggaatcgatgtcggggctaaaatttctcctatcttagagtcagagcttggcgaacgc
tttaaggctcctgcagccttcgataagctgcttgcagacgatcgaaaaggtcgtaagaat
ggtaaaggtttttatctttatggcagcaaggctaaacagagatttaagaagaaagcgaag
ctggtcgatgagtcagtctatgcagtgcttggtttaacgcctacatcaacggatagtaat
aacgactctcaggatgttgctcagcgttgtgtcgtgcagatgcttaatgaagccgttcgt
tgtctggaagaggggattatcgcctcaccacgtgatggtgatattggtgccatcttcgga
atcggtttcccgccgtttcttggaggcccgttccattatatcgattcaatgggagccgct
gagctggtggcagtattggaaacttatcaggccaaatttggagataggtttacaccttgc
gatcgtttaaaagagatggctgaaaatggactgtccttttttgaataa

DBGET integrated database retrieval system