KEGG   Shewanella sediminis: Ssed_1681Help
Entry
Ssed_1681         CDS       T00596                                 

Definition
(GenBank) Tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sse  Shewanella sediminis
Pathway
sse00260  Glycine, serine and threonine metabolism
sse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01130  Biosynthesis of antibiotics
sse01230  Biosynthesis of amino acids
Module
sse_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssed_1681
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssed_1681
Enzymes [BR:sse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ssed_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABV36292
JGI: Ssed1681
UniProt: A8FTW9
Position
complement(2014834..2015652)
Genome map
AA seq 272 aa AA seqDB search
MTESKQAGRYQATFAALKAKNQGAFVPFVTLGDPGPELSLKIIDTLVENGADALELGFPF
SDPLADGPVIQGANLRALDAGTTPTQCFEMLSAIRAKYPELPIGLLLYANLVYANGVDTF
YAKANAAGVDSVLIADVPVEEAEPFILSAKKHDIAPIFIAPPNADSETLKLVSEKGAGYT
YLLSRAGVTGTESKAGMPIGDILNRLKEFDGAPPLLGFGIAEPSQVKAAIQAGAAGAISG
SAVVKIIDANKANETILLAKLGEFTRDMKAAT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatctaaacaagcaggccgttatcaggcaacatttgccgcactgaaagctaaa
aaccagggcgcatttgtcccctttgtcaccttaggcgatccaggccctgaactgtcactg
aaaattatcgacaccttagtggaaaacggcgcagatgcgctcgaactgggcttcccgttt
tcagaccctttagccgatggccccgtcattcagggcgcgaatctacgcgcactcgatgca
ggcaccactccgacgcaatgcttcgagatgcttagtgccattcgcgctaaatacccggag
ctccccattggcctgctgttatacgccaacttagtgtacgccaacggtgtggataccttt
tatgctaaggccaatgctgctggcgtcgattcggtattgattgccgacgtgcccgtcgag
gaggccgaaccatttatcctgtcggccaagaaacatgacatcgcacctatctttatcgca
ccacccaatgccgacagcgaaacccttaagcttgtcagtgaaaaaggggctggttacacc
tacctcttgtcccgtgcaggcgttaccggcaccgaatcaaaggcaggcatgcccatcggt
gatattctgaatcgcttaaaagagtttgatggtgcgccgccactgcttggttttggtatt
gccgagccttctcaggtcaaggctgccatacaggctggcgccgctggggcaatatcaggc
tctgccgtagtaaaaatcatcgatgcaaataaagctaacgaaacgattctcttagccaaa
cttggcgagtttacccgtgatatgaaagctgcgacataa

DBGET integrated database retrieval system