KEGG   Shewanella sediminis: Ssed_1696Help
Entry
Ssed_1696         CDS       T00596                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sse  Shewanella sediminis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ssed_1696
Enzymes [BR:sse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ssed_1696
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Ssed_1696
Lipid biosynthesis proteins [BR:sse01004]
 Fatty acid synthase
  Component type
   Ssed_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2032795..2033391)
Genome map
AA seq 198 aa AA seqDB search
MLKSALGLFTLATVFFCTQLSAAPILILGDSLSASYGVDEDKGWVNLLRAKLPEHEIING
SVSGETTAGGLRRLPALLESAKPELILIELGGNDGLRGFTPQQLKENLTKIITLSQAKDV
EVLLSEIMVPPNYGPRYASMFSQVYKDLANEHEITLLPFFMTQIATKPELMQRDGIHPNA
EAQGDIAEFILPWVKNAL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatctgctctgggcctgtttaccctggcgactgttttcttttgcactcaatta
tctgctgcccctatattaatcctaggtgatagccttagtgcaagttatggtgtcgatgaa
gataagggctgggtgaaccttttaagagctaaactccccgaacatgagataataaatggc
tcggtcagcggtgaaacaaccgcgggcggattgcgtagactgcccgctctgcttgagtct
gccaagcccgagttaatattaattgagctgggtgggaatgacggattgcgtggttttact
cctcagcaactgaaagaaaatcttacaaaaataattactctctctcaggctaaagatgtc
gaagtgctcctctctgagattatggtcccaccaaactatggccccagatacgcttcaatg
ttctcacaggtgtataaagatctggcgaacgaacatgagatcaccctactgccttttttc
atgactcagatagcaacaaaaccggaattgatgcaacgagatggcatacacccaaatgct
gaggctcaaggcgatatcgcagagtttatccttccatgggtcaaaaatgcgctttag

DBGET integrated database retrieval system