KEGG   Shewanella sediminis: Ssed_1838Help
Entry
Ssed_1838         CDS       T00596                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sse  Shewanella sediminis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sse00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2211309..2212970)
Genome map
AA seq 553 aa AA seqDB search
MCSIFAILDIKSDATPLRQVALEMSKLLRHRGPDWSGIYSCDKAILAHERLAIVDIEHGA
QPLISQDESIILAVNGEIYNHKELKAELGDKYSYQTNSDCEVILSLYQEYGAEFLDKLNG
IFAFVLYDKSKDLYLIGRDHMGIIPLYTGLDAEGNFYIASEMKALMPVCKTVEEFKPGHY
MTSSEGYVHYYQRDWREFDAVKENPASVEELRDALEASVKRQLMSDVPYGVLLSGGLDSS
VISAITQTFAKRRIEDDGESSAWWPQLHSFAVGLEGAPDLIAAKKVADAIGTIHHEITFT
FQDGIDAIKDVIYHLETYDVTTIRAATPMYLMARKIKAMGIKMVLSGEGADELFGGYLYF
HKAPNAQAFHEELVRKLDKLHLFDCLRANKAMAAWGLEARVPFLDKEFMDVAMRINPEAK
MSKDGKIEKHILRQAFEHKLPKEVAWRQKEQFSDGVGYSWIDGLKELAEEKVDDLKLANA
KFRFPYNTPETKEAYFYRSFFEELFPLPTAAETVPGGKSVACSTPEALAWDESLQGIIDP
SGRAVRSVHEQAY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatatttgccattttagatattaagtctgatgcaacaccacttcgtcaggtt
gcgctggagatgtctaaactacttcgtcatcgcggtcccgattggtcagggatctacagc
tgtgataaagctattctcgctcacgagcgtctcgctattgtcgatattgaacacggtgct
caacctctgatcagccaagacgaaagcatcattcttgctgtcaacggtgagatctataac
cacaaagaactcaaggccgagttaggcgataagtacagctatcaaaccaactctgactgt
gaagtgatcctatccctctatcaggagtatggtgcagagtttctggacaaacttaacggt
atattcgcctttgttttatatgataagagcaaagatctttatctgatcggtcgcgaccat
atggggatcatcccgctttacacgggtctcgatgcagagggtaacttctatatcgcttcg
gaaatgaaagccttgatgccggtatgtaaaacggtagaagagtttaagcccggtcactat
atgaccagcagcgagggttacgttcattactatcaacgtgactggcgagagtttgatgcg
gtaaaagagaacccggccagtgtcgaagagctcagagatgcgcttgaagcctcggtaaag
cgtcagttgatgtctgatgtcccttatggtgtcttactctccggcggcctcgactcttcg
gttatctcagcaatcactcagaccttcgctaagcgtcgcatcgaggatgatggtgagagc
agtgcatggtggccgcaacttcactcttttgccgtggggcttgaaggtgcaccagatttg
attgccgccaaaaaagtggccgatgcaattggaacgattcaccatgagatcacctttacc
ttccaggatggtatcgatgcgatcaaagatgtgatttatcatctggaaacttatgatgtc
accaccattcgcgccgcgacacctatgtacttgatggcaaggaaaattaaagccatgggc
ataaagatggtgctatcaggtgaaggcgccgatgagttatttggcggttacctctacttc
cataaggcgccaaacgctcaggcattccacgaagagttagtacgaaaacttgataaactg
cacctgttcgattgcctgcgtgcaaacaaggcgatggctgcctggggactggaagcacgt
gtacctttcctcgacaaagagttcatggatgtcgcaatgcgcattaacccggaagccaaa
atgtctaaagatggcaagattgagaagcatattcttcgtcaagccttcgaacacaagtta
cctaaagaggtggcttggcgccaaaaggagcagttcagtgatggcgtgggctactcctgg
attgatggtttgaaagagctggccgaagagaaagttgacgaccttaaattagcgaacgca
aaattcaggttcccttataacacacctgaaactaaggaagcttatttctatcgcagcttc
tttgaagagctcttcccactgcctacagccgctgaaacggttccaggcggcaaatcggta
gcctgctcgacacctgaagccttagcatgggatgagagcctgcaaggtatcatagaccca
tcgggacgagcggtgcgctcggttcatgaacaggcctattaa

DBGET integrated database retrieval system