KEGG   Shewanella sediminis: Ssed_1935Help
Entry
Ssed_1935         CDS       T00596                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sse  Shewanella sediminis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ssed_1935
Enzymes [BR:sse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ssed_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2326656..2328707)
Genome map
AA seq 683 aa AA seqDB search
MIQSTQPIKALLKVWESERLITPLDRHFALEMAQLHKIKLHKTEHADHTYSELFLLICAL
LSRQLSQQHTCLPIHQIMLDNPMQEPISNCQILCSHNEIIEILAQFNAISSPGLEQASSP
STPIILDNGDLYLQRYYQFETQVASYLTLLADVEINEQPTEINHTRSTLEMLFPQSDEMG
ATDFDWQKIATATAFTKRLAVITGGPGTGKTTTVTKLLFLLTQQAAMTIRLVAPTGKAAA
RLSESIKASKVRLKMELAPFADQIDLTSLSRVPEEASTLHRLLGVIPNSPKFRHHKDNPL
RLDLLVVDEASMVDLPMMHKLLSALPTHARLILLGDQDQLASVEAGAVLADICAGLKQKN
TRTNASDAKWQMRYSSDYAGYLSTLSGFDLSPFISQSPKIGDSLCMLMHSHRFKGDAGIG
QLAGAVNNSDKGRIMQVWQTGYDELLWIEHLKTNAGNSGLDALLTQAVEHYRRYLEMAKD
DNKDASEIIDCYNEFRVLCAMRAGEYGVDGINQGVTAALKQAKLISADTEFYPGRPVIIQ
SNDYNLGLFNGDIGLILPDDLNTVSDHLAQDGDTAKHSARLMAHFIQADGSILKVLPARL
PSHDTCFAMTVHKSQGSEFANVALVLPIWPSPAQKQLLTKELVYTAITRAKLHFTCLGSQ
AVFEHASLQATQRSSGLARRLWG
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgatccagtcaacacagccaatcaaagccctgctgaaagtctgggagtctgagcgatta
attacaccactggacagacacttcgcactcgagatggctcagctacataagattaagcta
cacaagacagaacacgctgaccacacatatagtgaactatttctgcttatctgtgcccta
ttgagtcgacagctttctcagcagcacacctgcctgccgatacatcagattatgctcgat
aatccgatgcaggagccgatatcaaattgtcagatactgtgcagccacaatgaaatcatt
gagatattagcgcagttcaatgcaattagttcaccgggtttggagcaagccagctcacct
tcaacaccgataattttagacaatggcgatctgtacctgcagcgctattatcagttcgag
actcaagtcgcgagttacctcaccctgttagccgatgttgaaataaatgagcagcccaca
gagatcaatcatacccgcagcacattagagatgctgttcccccaaagcgatgagatgggt
gccaccgactttgactggcaaaaaatagcaacggctaccgcctttaccaaacgtttagcg
gtaataaccggtggcccgggcacgggtaaaaccaccacggtaactaaattgctgttttta
ctgacacagcaagcggccatgaccatacgattagttgcgccgacgggtaaggctgccgcg
cgattgagtgagtcaatcaaagcctcgaaggtgcgcctgaaaatggaactggcaccgttt
gccgaccaaattgatttaaccagcttgagccgggtaccggaggaggcctccaccctgcac
cgcttgcttggcgtgatcccgaactcccccaaattcaggcaccataaagataaccccctc
aggctggatctgctcgttgtagatgaagcctctatggtcgacctgcccatgatgcacaag
ctgctctcggcgctccccacacatgccagactcattctactgggcgatcaagatcagtta
gcctcggtggaagccggggccgtgttagcagacatctgtgctggattaaaacagaaaaat
accagaacaaatgccagtgatgccaagtggcagatgcgatattcgagcgactatgccggg
tatctttctacattatcagggtttgaccttagcccctttatcagccagtcacctaagatt
ggcgatagcctgtgtatgctgatgcacagccacagatttaaaggagatgcaggcataggt
caactggcaggtgcggtcaataactcagacaaaggccgaattatgcaggtatggcaaacc
ggatatgatgagctattgtggattgaacacctgaaaaccaatgcaggcaattcggggcta
gatgcactactcacccaagcggtggagcattatcggcgatatctcgagatggctaaagat
gacaacaaagatgccagtgaaatcatcgattgttataacgagtttcgagtattatgtgcc
atgcgggcgggcgagtatggtgtcgatggcatcaatcagggtgtgaccgccgcactgaag
caggccaaacttatcagtgccgacaccgagttttatccgggccgcccggtgataatccaa
agcaacgattataacctggggctatttaacggcgatattggccttatcttaccggatgac
ttaaacacggtatcagatcatttagcccaagatggcgatacggcgaaacactctgcccgc
ctgatggcacactttattcaggccgatggcagtatcttaaaggtgctacccgcacgcctt
ccaagccacgatacctgctttgccatgacggtacataagagccagggcagcgagtttgcc
aatgtagcgctcgtgctgcccatctggcccagcccggcccaaaaacagttgctgacaaag
gaactggtttatacggccatcacccgcgccaagctgcattttacctgcctgggctcacaa
gccgttttcgagcatgccagcctgcaggccactcaacgctcgtccgggcttgcgagacgt
ttatggggatag

DBGET integrated database retrieval system