KEGG   Shewanella sediminis: Ssed_1935Help
Entry
Ssed_1935         CDS       T00596                                 

Definition
(GenBank) Exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sse  Shewanella sediminis
Pathway
sse03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ssed_1935
Enzymes [BR:sse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ssed_1935
DNA repair and recombination proteins [BR:sse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Ssed_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 UvrD_C AAA_22 DUF2075 UvrD-helicase AAA_16 PhoH CbiA SRP54 NTPase_1 T2SSE TrwB_AAD_bind ArgK SMC_N AAA_29 AAA_28 AAA_5 AAA_24 AAA_23
Motif
Other DBs
NCBI-ProteinID: ABV36546
JGI: Ssed1935
UniProt: A8FUM3
Position
complement(2326656..2328707)
Genome map
AA seq 683 aa AA seqDB search
MIQSTQPIKALLKVWESERLITPLDRHFALEMAQLHKIKLHKTEHADHTYSELFLLICAL
LSRQLSQQHTCLPIHQIMLDNPMQEPISNCQILCSHNEIIEILAQFNAISSPGLEQASSP
STPIILDNGDLYLQRYYQFETQVASYLTLLADVEINEQPTEINHTRSTLEMLFPQSDEMG
ATDFDWQKIATATAFTKRLAVITGGPGTGKTTTVTKLLFLLTQQAAMTIRLVAPTGKAAA
RLSESIKASKVRLKMELAPFADQIDLTSLSRVPEEASTLHRLLGVIPNSPKFRHHKDNPL
RLDLLVVDEASMVDLPMMHKLLSALPTHARLILLGDQDQLASVEAGAVLADICAGLKQKN
TRTNASDAKWQMRYSSDYAGYLSTLSGFDLSPFISQSPKIGDSLCMLMHSHRFKGDAGIG
QLAGAVNNSDKGRIMQVWQTGYDELLWIEHLKTNAGNSGLDALLTQAVEHYRRYLEMAKD
DNKDASEIIDCYNEFRVLCAMRAGEYGVDGINQGVTAALKQAKLISADTEFYPGRPVIIQ
SNDYNLGLFNGDIGLILPDDLNTVSDHLAQDGDTAKHSARLMAHFIQADGSILKVLPARL
PSHDTCFAMTVHKSQGSEFANVALVLPIWPSPAQKQLLTKELVYTAITRAKLHFTCLGSQ
AVFEHASLQATQRSSGLARRLWG
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgatccagtcaacacagccaatcaaagccctgctgaaagtctgggagtctgagcgatta
attacaccactggacagacacttcgcactcgagatggctcagctacataagattaagcta
cacaagacagaacacgctgaccacacatatagtgaactatttctgcttatctgtgcccta
ttgagtcgacagctttctcagcagcacacctgcctgccgatacatcagattatgctcgat
aatccgatgcaggagccgatatcaaattgtcagatactgtgcagccacaatgaaatcatt
gagatattagcgcagttcaatgcaattagttcaccgggtttggagcaagccagctcacct
tcaacaccgataattttagacaatggcgatctgtacctgcagcgctattatcagttcgag
actcaagtcgcgagttacctcaccctgttagccgatgttgaaataaatgagcagcccaca
gagatcaatcatacccgcagcacattagagatgctgttcccccaaagcgatgagatgggt
gccaccgactttgactggcaaaaaatagcaacggctaccgcctttaccaaacgtttagcg
gtaataaccggtggcccgggcacgggtaaaaccaccacggtaactaaattgctgttttta
ctgacacagcaagcggccatgaccatacgattagttgcgccgacgggtaaggctgccgcg
cgattgagtgagtcaatcaaagcctcgaaggtgcgcctgaaaatggaactggcaccgttt
gccgaccaaattgatttaaccagcttgagccgggtaccggaggaggcctccaccctgcac
cgcttgcttggcgtgatcccgaactcccccaaattcaggcaccataaagataaccccctc
aggctggatctgctcgttgtagatgaagcctctatggtcgacctgcccatgatgcacaag
ctgctctcggcgctccccacacatgccagactcattctactgggcgatcaagatcagtta
gcctcggtggaagccggggccgtgttagcagacatctgtgctggattaaaacagaaaaat
accagaacaaatgccagtgatgccaagtggcagatgcgatattcgagcgactatgccggg
tatctttctacattatcagggtttgaccttagcccctttatcagccagtcacctaagatt
ggcgatagcctgtgtatgctgatgcacagccacagatttaaaggagatgcaggcataggt
caactggcaggtgcggtcaataactcagacaaaggccgaattatgcaggtatggcaaacc
ggatatgatgagctattgtggattgaacacctgaaaaccaatgcaggcaattcggggcta
gatgcactactcacccaagcggtggagcattatcggcgatatctcgagatggctaaagat
gacaacaaagatgccagtgaaatcatcgattgttataacgagtttcgagtattatgtgcc
atgcgggcgggcgagtatggtgtcgatggcatcaatcagggtgtgaccgccgcactgaag
caggccaaacttatcagtgccgacaccgagttttatccgggccgcccggtgataatccaa
agcaacgattataacctggggctatttaacggcgatattggccttatcttaccggatgac
ttaaacacggtatcagatcatttagcccaagatggcgatacggcgaaacactctgcccgc
ctgatggcacactttattcaggccgatggcagtatcttaaaggtgctacccgcacgcctt
ccaagccacgatacctgctttgccatgacggtacataagagccagggcagcgagtttgcc
aatgtagcgctcgtgctgcccatctggcccagcccggcccaaaaacagttgctgacaaag
gaactggtttatacggccatcacccgcgccaagctgcattttacctgcctgggctcacaa
gccgttttcgagcatgccagcctgcaggccactcaacgctcgtccgggcttgcgagacgt
ttatggggatag

DBGET integrated database retrieval system