KEGG   Shewanella sediminis: Ssed_2077Help
Entry
Ssed_2077         CDS       T00596                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sse  Shewanella sediminis
Brite
Enzymes [BR:sse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Ssed_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2515587..2516618
Genome map
AA seq 343 aa AA seqDB search
MNLAKHLSDTEVSAKILRHAVPKMSEHNIPVTPDNYAVWYEYYLGINLDLKRAIDGLISN
GISFSTEVNAGLYKNFIQEQSSEIIENVQIETQILINNLLTKISQMNSGTASLNDTLSEF
HQDLKQSPDADVLQKLVDSLVDEMDNVISSNKQMEASLNAMSSEVNSLKSEMESLNVLAL
TDQLTSLHNRRAFEEEVLIHMQRLTKTQESSCLLVIDIDHFKQFNDNHGHVIGDKVLTYI
ALALNQAVKGSDFVARYGGEEFVVLLPDTELADALIVAEQLRSKIADRKLTVGKDKKLSL
GSITVSIGAATLNISDDRESYFVRADEALYRAKSCGRNCVRSE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagctaaacatctctcagatactgaagtatcggcaaaaattctcaggcatgcg
gtgcctaagatgtctgaacacaatattcccgtaacaccagataattacgccgtatggtat
gaatattaccttggaattaatctggacttgaagcgggcgatagacggtttgatctcaaac
ggcatctcctttagcacagaggttaatgcagggttatataagaattttattcaagagcag
tcgtctgaaattattgaaaatgttcagattgaaactcagatcctgattaataatctattg
acgaaaatcagtcagatgaacagcggcaccgccagtttgaatgatactctttccgaattt
catcaagatctaaaacagagccctgacgccgatgtgttacagaaacttgtcgatagcctg
gtcgatgagatggacaatgtcattagcagtaacaagcagatggaggcgagccttaatgcg
atgagcagtgaggtaaactcattgaaatctgagatggaaagcctcaatgtcctggctctg
acagatcaactgacctctttacataatcgtcgtgctttcgaagaggaagtgctgatacac
atgcagcgtttaaccaagactcaagaatccagctgtttattggtcatcgatatcgatcac
tttaagcagttcaatgataatcatggtcatgttattggtgataaggtgttgacgtatatc
gccttagccttaaatcaagctgttaagggaagcgacttcgtagccagatacgggggggaa
gagtttgttgttctgctccccgatactgaattggccgatgccttgatcgttgccgagcag
ttgcgcagtaaaattgccgatcgaaaattgacggtaggaaaagataaaaagctctcctta
ggctcgattactgtgtctataggcgcagcgacgcttaatatcagtgatgacagagagagt
tactttgtcagagccgacgaagccctgtaccgtgctaaatcatgcggtagaaactgtgta
agaagtgagtag

DBGET integrated database retrieval system