KEGG   Shewanella sediminis: Ssed_2351Help
Entry
Ssed_2351         CDS       T00596                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sse  Shewanella sediminis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssed_2351
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ssed_2351
   00630 Glyoxylate and dicarboxylate metabolism
    Ssed_2351
Enzymes [BR:sse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ssed_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2860134..2862308)
Genome map
AA seq 724 aa AA seqDB search
MTSRIQVGNLQVATMLYELINEQIIPGTGIDSDRFWTKFEALIDDLGPKNRALLEKRDEL
QQQIDQWHLTHKQHEPDAYKAFLTKIGYLVPEGEDFLVSTANVDIEIAEQAGPQLVVPVK
NARFALNAANARWGSLYDALYGTDAISFDGGAEITAHFNPVRGAKVVAFAKQHLDTLAPL
AVGSHSEVVHYQVDGASLLVTLSDGCDTRLREPEKFIGYQGDEKSPTAILLKNNGLHVEI
QIDGEHPIGKTDKANVKDLLVEAAVTTIMDCEDSVAAVDAEDKCEIYRNWLGLMQGTLSA
EVKKSGKSFTRELNEDRQYKDTEGRNLTLPGRSLLFIRNVGHLMTNNAILDKEGNEIPEG
ILDGMVTVLAAMHDLKGNNNKRSNSRAGSVNIVKPKMHGPEEVEFTCELFTRIEDALKLS
RDTIKLGIMDEERRTTVNLKECIRVAQDRVVFINTGFLDRTGDEIHTSMLAGPFVPKTQM
KQQAWINAYEDWNVDIGLACGLPGKAQIGKGMWAMPDEMAAMLAQKGAHPTAGANTAWVP
SPNGATLHSLHYHQINVQDRQQLLCERERASLEDILTIPLLENPAELTHEQIQRELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLEHGICTEEQVIASM
HKMAKVVDKQNEADRQYINMAPEFDGIAFKAACDLIFKGKDQPSGYTEPLLHAYRIEAKS
RQQA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgaattcaagttggcaatctgcaagtggcaactatgctctatgaattgatc
aatgagcagatcattccggggacagggatcgactcagatagattctggactaagtttgaa
gccttaatcgatgacctcggacccaagaaccgagcacttctagaaaaacgtgatgaatta
cagcagcaaatcgatcagtggcacttaacccataagcagcatgaacctgacgcctataag
gcgttcttgaccaagattggttatcttgttcctgaaggtgaagattttttggtgtcgacg
gcaaatgtggatatcgaaatagcagagcaagccggtcctcagttagtggtgccggttaaa
aatgcacgatttgccttaaatgctgctaatgcccgatggggcagcttatatgatgccttg
tatggtaccgatgctattagcttcgatggcggcgcagaaataactgcacactttaatcct
gttcgcggtgcaaaagttgtcgcgttcgctaaacaacacttagatacactggccccgtta
gccgttgggagtcatagtgaagtcgttcattatcaggtcgatggggcaagcctgttggtt
acgctatcagacggttgcgatactcgcttacgggagccggaaaagtttattggctatcaa
ggagatgagaagtcaccaacagcgattttattgaaaaataacggcctacatgtagagata
cagatagatggcgaacatcctatcggtaagaccgataaagccaatgtcaaagatctactc
gtcgaagccgccgtcaccaccattatggattgtgaagactccgtcgctgccgtcgatgcc
gaagataagtgtgaaatataccgtaattggcttggtcttatgcaaggcactctgtctgca
gaggtgaaaaaaagtggtaagagcttcacccgtgagttaaacgaggatcgccagtataaa
gacaccgaggggagaaacctgactctaccgggcagaagtctgttgtttattcgtaatgtt
ggtcatttgatgacaaataatgcgattttagacaaagagggtaacgagatcccggaaggg
atcttagacggcatggtgactgtgctcgccgctatgcatgatctaaaaggcaacaataac
aagcgatcgaatagccgtgcgggatccgttaatatcgttaagcccaagatgcacggtccc
gaagaggtcgagtttacctgcgagctgttcactagaattgaagatgcgctcaagttatcc
cgtgacaccattaagttgggcattatggatgaggaacgcagaaccacagtcaacctcaag
gagtgtattagggtcgcacaagatagggtcgtgtttatcaataccggttttctggaccgc
accggagatgaaatacatacttcgatgcttgccgggcctttcgttcccaagactcagatg
aaacagcaagcctggattaatgcctatgaagattggaatgtcgatattggtttggcctgt
gggctacctggaaaagcgcagataggaaagggaatgtgggcgatgcccgatgagatggca
gctatgttagctcagaaaggtgctcatccaaccgccggagcgaatacggcatgggtaccg
tcgcccaatggagcaaccttacactctttgcactaccatcagatcaatgtacaggatcga
caacagctactttgtgaacgagagcgggcgagtctggaggatatattgacgattccactg
cttgaaaatccggcagaactgactcatgaacagatccaacgtgaactcgacaataacgct
cagggaattttaggctatgtggtgcgctggatcgatcaaggggtgggctgctcgaaagta
ccggatattaacgatgtcggtttgatggaagacagggcaacgttaaggatctcatctcaa
catatcgccaactggctcgaacatggtatctgtactgaagagcaggtgatcgcttcaatg
cataagatggcgaaagttgtcgataaacaaaatgaagccgataggcagtatattaatatg
gcacctgaatttgacggtatcgcttttaaagcagcttgtgatctgatttttaaaggaaaa
gatcaaccatcaggatatacagagcctctattgcatgcctatcgcatcgaggcaaagtct
cgtcagcaggcgtaa

DBGET integrated database retrieval system