KEGG   Shewanella sediminis: Ssed_2351Help
Entry
Ssed_2351         CDS       T00596                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sse  Shewanella sediminis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sse01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sse00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sse00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2860134..2862308)
Genome map
AA seq 724 aa AA seqDB search
MTSRIQVGNLQVATMLYELINEQIIPGTGIDSDRFWTKFEALIDDLGPKNRALLEKRDEL
QQQIDQWHLTHKQHEPDAYKAFLTKIGYLVPEGEDFLVSTANVDIEIAEQAGPQLVVPVK
NARFALNAANARWGSLYDALYGTDAISFDGGAEITAHFNPVRGAKVVAFAKQHLDTLAPL
AVGSHSEVVHYQVDGASLLVTLSDGCDTRLREPEKFIGYQGDEKSPTAILLKNNGLHVEI
QIDGEHPIGKTDKANVKDLLVEAAVTTIMDCEDSVAAVDAEDKCEIYRNWLGLMQGTLSA
EVKKSGKSFTRELNEDRQYKDTEGRNLTLPGRSLLFIRNVGHLMTNNAILDKEGNEIPEG
ILDGMVTVLAAMHDLKGNNNKRSNSRAGSVNIVKPKMHGPEEVEFTCELFTRIEDALKLS
RDTIKLGIMDEERRTTVNLKECIRVAQDRVVFINTGFLDRTGDEIHTSMLAGPFVPKTQM
KQQAWINAYEDWNVDIGLACGLPGKAQIGKGMWAMPDEMAAMLAQKGAHPTAGANTAWVP
SPNGATLHSLHYHQINVQDRQQLLCERERASLEDILTIPLLENPAELTHEQIQRELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLEHGICTEEQVIASM
HKMAKVVDKQNEADRQYINMAPEFDGIAFKAACDLIFKGKDQPSGYTEPLLHAYRIEAKS
RQQA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgaattcaagttggcaatctgcaagtggcaactatgctctatgaattgatc
aatgagcagatcattccggggacagggatcgactcagatagattctggactaagtttgaa
gccttaatcgatgacctcggacccaagaaccgagcacttctagaaaaacgtgatgaatta
cagcagcaaatcgatcagtggcacttaacccataagcagcatgaacctgacgcctataag
gcgttcttgaccaagattggttatcttgttcctgaaggtgaagattttttggtgtcgacg
gcaaatgtggatatcgaaatagcagagcaagccggtcctcagttagtggtgccggttaaa
aatgcacgatttgccttaaatgctgctaatgcccgatggggcagcttatatgatgccttg
tatggtaccgatgctattagcttcgatggcggcgcagaaataactgcacactttaatcct
gttcgcggtgcaaaagttgtcgcgttcgctaaacaacacttagatacactggccccgtta
gccgttgggagtcatagtgaagtcgttcattatcaggtcgatggggcaagcctgttggtt
acgctatcagacggttgcgatactcgcttacgggagccggaaaagtttattggctatcaa
ggagatgagaagtcaccaacagcgattttattgaaaaataacggcctacatgtagagata
cagatagatggcgaacatcctatcggtaagaccgataaagccaatgtcaaagatctactc
gtcgaagccgccgtcaccaccattatggattgtgaagactccgtcgctgccgtcgatgcc
gaagataagtgtgaaatataccgtaattggcttggtcttatgcaaggcactctgtctgca
gaggtgaaaaaaagtggtaagagcttcacccgtgagttaaacgaggatcgccagtataaa
gacaccgaggggagaaacctgactctaccgggcagaagtctgttgtttattcgtaatgtt
ggtcatttgatgacaaataatgcgattttagacaaagagggtaacgagatcccggaaggg
atcttagacggcatggtgactgtgctcgccgctatgcatgatctaaaaggcaacaataac
aagcgatcgaatagccgtgcgggatccgttaatatcgttaagcccaagatgcacggtccc
gaagaggtcgagtttacctgcgagctgttcactagaattgaagatgcgctcaagttatcc
cgtgacaccattaagttgggcattatggatgaggaacgcagaaccacagtcaacctcaag
gagtgtattagggtcgcacaagatagggtcgtgtttatcaataccggttttctggaccgc
accggagatgaaatacatacttcgatgcttgccgggcctttcgttcccaagactcagatg
aaacagcaagcctggattaatgcctatgaagattggaatgtcgatattggtttggcctgt
gggctacctggaaaagcgcagataggaaagggaatgtgggcgatgcccgatgagatggca
gctatgttagctcagaaaggtgctcatccaaccgccggagcgaatacggcatgggtaccg
tcgcccaatggagcaaccttacactctttgcactaccatcagatcaatgtacaggatcga
caacagctactttgtgaacgagagcgggcgagtctggaggatatattgacgattccactg
cttgaaaatccggcagaactgactcatgaacagatccaacgtgaactcgacaataacgct
cagggaattttaggctatgtggtgcgctggatcgatcaaggggtgggctgctcgaaagta
ccggatattaacgatgtcggtttgatggaagacagggcaacgttaaggatctcatctcaa
catatcgccaactggctcgaacatggtatctgtactgaagagcaggtgatcgcttcaatg
cataagatggcgaaagttgtcgataaacaaaatgaagccgataggcagtatattaatatg
gcacctgaatttgacggtatcgcttttaaagcagcttgtgatctgatttttaaaggaaaa
gatcaaccatcaggatatacagagcctctattgcatgcctatcgcatcgaggcaaagtct
cgtcagcaggcgtaa

DBGET integrated database retrieval system