KEGG   Shewanella sediminis: Ssed_2353Help
Entry
Ssed_2353         CDS       T00596                                 

Definition
(GenBank) isocitrate lyase and phosphorylmutase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sse  Shewanella sediminis
Pathway
sse00630  Glyoxylate and dicarboxylate metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01200  Carbon metabolism
Module
sse_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ssed_2353
Enzymes [BR:sse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ssed_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABV36962
JGI: Ssed2353
UniProt: A8FVT9
Position
2863595..2865178
Genome map
AA seq 527 aa AA seqDB search
MSNYRADIDTATTLLEKEGSAWNAINPESVARMRAQNQFKTGLDIAKYTAKIMREDMANY
DADSSQYTQSLGCWHGFIGQQKMIAIKKHLLTTKRRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVASLIAELYTFLRQADARELGGLFRELDKAEGADKAAVQDKIDNFETHVVPIIAD
IDAGFGNEEATYLMAKQMIEAGACCIQLENQVSDVKQCGHQDGKVTVPHIEFLAKINAVR
YAFLELGIDDGVIVARTDSLGAGLTQKIAVTTEPGDLGDQYNSFLEVEEVSTDNLLNGDV
VFKRGDKLVKPSRLPNGLFKFRSGTGEERCVLDCITSLQNGADLLWIETEKPHVAQIGAM
VNAIRETVPNAKLVYNNSPSFNWTLNFRQQIFDAMAEAGKDVSGYDRAKLMSIDYDETEL
AIEADEKIRTFQADAAREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQR
KEIRQGIACVKHQNMAGSDMGDDHKGYFSGDQALKASGKDNTMNQFG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattacagagcagatatcgatacagcaacaaccttgttagagaaagaaggtagc
gcctggaatgcaatcaaccctgaatcagtagcccgtatgcgagctcagaaccaatttaag
acaggtttggacattgccaagtataccgccaaaataatgcgcgaagacatggctaactat
gatgcagacagctcacagtacactcaatcactgggttgctggcacgggtttatcggccaa
cagaagatgatcgcgattaagaagcatcttttaacgactaaacgccgttacctgtaccta
tctggctggatggttgcagcactgcgcagcgagttcggcccactgccggatcagtctatg
cacgaaaaaacgtctgtcgccagccttatcgccgagttatacaccttccttcgtcaggcc
gatgcccgtgaattaggtggactatttcgcgaactggataaagccgaaggtgcagataaa
gccgctgtacaagacaagattgataactttgaaactcatgtagtaccgattatcgccgac
atcgacgccggttttggtaatgaagaagccacctacctgatggcaaaacagatgattgaa
gcgggtgcctgttgtatccagcttgaaaaccaggtatctgatgtgaaacagtgcggacac
caggacggtaaagtcacggtgccacatattgagtttcttgccaagatcaatgctgtacgt
tacgcattcctcgagcttggcatcgacgatggtgtcattgttgcccgtaccgactcattg
ggtgcaggtctgacacagaagattgcagtaaccactgaacctggcgatctgggcgaccaa
tacaactcattccttgaagttgaagaggtatcgaccgataacttactcaatggggatgta
gtatttaaacgcggtgacaaactcgttaagccatcacgccttccaaacggcctgtttaag
ttcagatcgggtacgggtgaagagcgttgcgttcttgactgtatcaccagcctgcaaaac
ggtgcagatctattgtggattgaaacagagaagcctcacgttgcccaaattggcgctatg
gtaaacgctatccgtgaaaccgtaccgaatgccaagcttgtttataacaactcaccttcg
tttaactggacgcttaatttccgtcagcagatcttcgatgcgatggcagaagcgggtaag
gatgtatcgggttacgatcgtgctaagttaatgagcatcgattatgacgaaacagagctt
gcgatagaagccgatgagaagatccgtaccttccaggctgatgcggcgcgtgaagcgggt
atcttccaccacctgatcacactaccgacataccatactgcggccttgtctacagataac
ctggctaaagagtacttcggtgaccaaggtatgctgggttatgtagccggcgtacagcgc
aaggagatccgtcagggcatcgcttgtgttaaacaccagaacatggcggggtcagatatg
ggtgatgatcacaaagggtacttctccggagaccaggcactgaaagcatccggtaaagac
aacacaatgaaccaatttggttaa

DBGET integrated database retrieval system