KEGG   Shewanella sediminis: Ssed_2684Help
Entry
Ssed_2684         CDS       T00596                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sse  Shewanella sediminis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3240316..3241308
Genome map
AA seq 330 aa AA seqDB search
MKLLSPLSLAILAAMSAAPAAAKEPIEIIQPAKITAPEKVELGKMLFFEPRLSMSGFISC
NSCHNLSLGGVDALPTSIGHNWQEGPINSPTVLNAEYGLAQFWDGRAKDLKEQAGGPIAN
PGEMGYTHELAVSTVNSMPAYQTKFEAIYGKNSVNIDNITDAIAEFEKTLVTPNSSFDLY
LQGEQDAITAEAKSGYQLFKNKGCTSCHNGPAVGGTMYMKMGLVKPFHTKNPAEGRIAVT
GKEADKYVFKVPTLRNIELTYPYFHDGATWTLEEAVNTMADIQLGQQLSEKETVEMVAFL
KSLTGEQPQIVLPILPPSNANTPKPVPFEK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattatctcccctttctcttgcaatcctggctgcaatgagcgcagcacctgcc
gcagcaaaagagccaattgaaattatccaaccagcaaagatcacggcaccagaaaaagtt
gaattgggaaagatgttgttcttcgagccaaggctctcaatgtctggttttatctcctgt
aactcatgccataacctatcgcttggcggtgtcgatgcacttccaacctctattggacac
aactggcaagagggcccgattaactctcctacggtcctgaatgctgaatacggtctggca
caattttgggacgggcgtgcaaaagatctcaaagaacaagccggtgggccaatcgctaat
cctggagagatgggttatacccatgagcttgccgtctcaactgtaaactccatgccagcc
taccagacaaagtttgaagccatttatggtaagaactcggtcaacattgacaatattacc
gatgccatcgccgagtttgaaaaaacactggttacgccgaacagttctttcgatctctat
cttcaaggagagcaggacgcgatcaccgccgaagcaaaatcaggttatcagctctttaaa
aataaaggttgtaccagctgtcacaatggacccgcggttggtggcaccatgtatatgaag
atgggactagtgaaaccgttccacactaaaaacccggcagagggtcgcatcgctgtaact
ggaaaagaggccgataaatatgtctttaaagttccgacactgcgcaatatcgaactaacc
tacccttactttcacgatggtgcgacctggaccttagaggaagcggtcaacacgatggct
gatattcagcttggtcagcaattatctgagaaagagacagttgagatggtggcatttctt
aagtcgctcaccggagagcagccacagatagtgttacctatcctgccaccatcgaatgcg
aatacacctaagcccgtcccttttgaaaaatag

DBGET integrated database retrieval system