KEGG   Shewanella sediminis: Ssed_2790Help
Entry
Ssed_2790         CDS       T00596                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sse  Shewanella sediminis
Brite
Enzymes [BR:sse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ssed_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3363468..3364202
Genome map
AA seq 244 aa AA seqDB search
MGKLLFLFITLILFEQQSLAALPTGDSEKYLRARESMVQNQLSTRDIKDKRVLTAMREVP
RHLFVPDLLVFKAYTDSPLPIGEGQTISQPYIVALMTELLELTGSERVLEIGTGSGYQAA
VLSQVAKEVFTIEIKEKLCTKAGKLLDSLGYTNIQARCGDGYFGWNKEAPFDAIMITAAV
DHVPPPLLAQLKDGGRLVLPLGNPFSYQNLVLVTRKGDDYRVWQISGVLFVPMTGHALKD
SGEK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaattactgtttctgtttattacccttatcctattcgaacagcagagccttgcg
gcattacccacgggtgattccgaaaaatatctccgcgccagagagagtatggtgcaaaat
cagctcagcacacgcgacataaaagacaagagagtactgacggcaatgagagaggttccc
agacatctctttgtcccggacctactggttttcaaagcctataccgactctcccctgccg
ataggtgaaggacagaccatttcacaaccctatattgttgccctgatgacggagctactc
gaactcaccggcagtgaaagagtgctagagattggaaccggctcaggataccaggcggcg
gtgctttcccaggtcgcaaaagaggtgttcaccattgagatcaaggagaaactctgcact
aaggccggcaaacttctggactctctgggttataccaatattcaggcccgctgcggtgac
ggctacttcggctggaacaaggaggcgcccttcgatgcgattatgatcaccgccgccgtg
gatcacgtccctccgccccttctggcgcagctcaaagacggaggacggctggtgcttccc
ctgggaaatcccttcagctatcagaacctggtgctggtcaccagaaagggggatgactat
agggtttggcagatctccggtgttctctttgttcccatgaccggacatgcattgaaggac
tccggggaaaagtaa

DBGET integrated database retrieval system