KEGG   Shewanella sediminis: Ssed_2812Help
Entry
Ssed_2812         CDS       T00596                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sse  Shewanella sediminis
Pathway
sse00020  Citrate cycle (TCA cycle)
sse00640  Propanoate metabolism
sse00660  C5-Branched dibasic acid metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01130  Biosynthesis of antibiotics
sse01200  Carbon metabolism
Module
sse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ssed_2812
   00640 Propanoate metabolism
    Ssed_2812
   00660 C5-Branched dibasic acid metabolism
    Ssed_2812
Enzymes [BR:sse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ssed_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A NUC153
Motif
Other DBs
NCBI-ProteinID: ABV37419
JGI: Ssed2812
UniProt: A8FX46
Position
complement(3393504..3394670)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALFAEYGLPVSEGFACDTPQEAVEAAGRIGGDMWVVKCQVHAGGRGKAGGV
KVTGSKDEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRSTRR
VVFMASTEGGVEIETVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKV
FMGLAKMFEDHDFALLEINPLVITDEGNIHCLDGKIGIDGNALFRQEKIRDMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTVPVVVRLEGTNADLGRDV
LASSDLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaagccctatttgccgaatatggtttaccagtgtca
gaaggttttgcttgtgacacacctcaagaagctgttgaagcggcaggccgtattggcgga
gatatgtgggttgttaagtgtcaagtacacgcaggcggccgtggtaaagcaggtggcgtt
aaagttacaggctctaaagatgagatcagagcatttgctgaacattggttaggtaagaac
ttagttacttaccagactgatgagaaaggccagccagtcgctaagattttagtcgaaagc
tgtactgacattgcgaatgaattgtacctgggtgcagttgtagaccgttcaacacgtcgc
gtcgtgtttatggcgtctaccgaaggtggtgttgaaattgagactgtggctgaagaaacg
ccagagcttattcacaaagccatcatcgatccactaaccggtcctcagccttaccaggcg
cgcgatcttggattcaagctaggtctaaacccgactcaaatgaagcaattcactaaagtc
tttatgggtttagcgaaaatgtttgaagatcatgattttgcactgcttgaaatcaaccca
ttagttattaccgacgaaggcaatattcactgtctagatggtaagatcggtatcgatggt
aatgcattgttccgtcaagagaagattcgtgacatgcacgatccatcgcaagatgatgct
cgtgaagcgcatgcggctaagtttgaacttaactatgttgcactagacggaaacgtgggt
tgcatggttaacggcgcaggcctggctatgggtacgatggatatcgtaaacttgcatggt
ggcaagcctgctaatttcttagatgtaggtggcggggcgactaaagagcgtgtagctgaa
gcatttaagatcattctgtcagatgacaatgttaaagccgtactggttaacattttcggt
ggaatcgttcgttgtgacatgatcgctgaaggtattattggcgcagtgaaagaggttggt
gtaactgtacctgttgtcgttcgtcttgaaggtactaacgccgatcttggtcgtgatgta
ctggcaagttctgatctcgatatcatcgcagctacaagtctaactgacgcagctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system