KEGG   Shewanella sediminis: Ssed_2812Help
Entry
Ssed_2812         CDS       T00596                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming) (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sse  Shewanella sediminis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssed_2812
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ssed_2812
   00640 Propanoate metabolism
    Ssed_2812
   00660 C5-Branched dibasic acid metabolism
    Ssed_2812
Enzymes [BR:sse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ssed_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3393504..3394670)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALFAEYGLPVSEGFACDTPQEAVEAAGRIGGDMWVVKCQVHAGGRGKAGGV
KVTGSKDEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRSTRR
VVFMASTEGGVEIETVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKV
FMGLAKMFEDHDFALLEINPLVITDEGNIHCLDGKIGIDGNALFRQEKIRDMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTVPVVVRLEGTNADLGRDV
LASSDLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaagccctatttgccgaatatggtttaccagtgtca
gaaggttttgcttgtgacacacctcaagaagctgttgaagcggcaggccgtattggcgga
gatatgtgggttgttaagtgtcaagtacacgcaggcggccgtggtaaagcaggtggcgtt
aaagttacaggctctaaagatgagatcagagcatttgctgaacattggttaggtaagaac
ttagttacttaccagactgatgagaaaggccagccagtcgctaagattttagtcgaaagc
tgtactgacattgcgaatgaattgtacctgggtgcagttgtagaccgttcaacacgtcgc
gtcgtgtttatggcgtctaccgaaggtggtgttgaaattgagactgtggctgaagaaacg
ccagagcttattcacaaagccatcatcgatccactaaccggtcctcagccttaccaggcg
cgcgatcttggattcaagctaggtctaaacccgactcaaatgaagcaattcactaaagtc
tttatgggtttagcgaaaatgtttgaagatcatgattttgcactgcttgaaatcaaccca
ttagttattaccgacgaaggcaatattcactgtctagatggtaagatcggtatcgatggt
aatgcattgttccgtcaagagaagattcgtgacatgcacgatccatcgcaagatgatgct
cgtgaagcgcatgcggctaagtttgaacttaactatgttgcactagacggaaacgtgggt
tgcatggttaacggcgcaggcctggctatgggtacgatggatatcgtaaacttgcatggt
ggcaagcctgctaatttcttagatgtaggtggcggggcgactaaagagcgtgtagctgaa
gcatttaagatcattctgtcagatgacaatgttaaagccgtactggttaacattttcggt
ggaatcgttcgttgtgacatgatcgctgaaggtattattggcgcagtgaaagaggttggt
gtaactgtacctgttgtcgttcgtcttgaaggtactaacgccgatcttggtcgtgatgta
ctggcaagttctgatctcgatatcatcgcagctacaagtctaactgacgcagctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system