KEGG   Shewanella sediminis: Ssed_2837Help
Entry
Ssed_2837         CDS       T00596                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sse  Shewanella sediminis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ssed_2837
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Ssed_2837
Enzymes [BR:sse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ssed_2837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3429254..3430255)
Genome map
AA seq 333 aa AA seqDB search
MLDLLSTQASEEELSQLQHPMVGGVILFSRNYSNRTQLIALIKQVRSVRPDILIAVDHEG
GRVQRFRDGFTAIPAMGDILPIAGKDMVLAKSWAVELGYLMAIELLACDIDLSFAPVLDL
NGISKVIGKRAFGSEPDVVIELAGSFIDGMEQAGMAAVGKHFPGHGSVEADSHFDQAVDN
RTRQQIVESDMRPFKQLIDQEKLHGVMPAHVIYPNIDPNPAGFSGYWLKQVLRNELAFKG
VIFSDDLGMEGAGVVGGYKARAQAALDAGCNMILLCNDAAGATEVLNELVWPETLPERPA
SLLKPRLDVVTKALEDDARWTRAKEIAGKFPIN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatctattatcgacccaagcgtcagaggaggaactgtcacagcttcagcaccct
atggtcggtggcgtgattttatttagtcgaaactactccaatcgaacccagcttatcgcc
ttaattaagcaagtgcgatccgtacggcctgatattctcatcgccgtcgatcatgaaggt
ggcagggtacagagattcagagacggttttaccgctattccagcgatgggggatatattg
cccatcgccggaaaagacatggtgttggcaaaatcctgggcagtagagcttggctatttg
atggctattgaactccttgcctgtgatatcgacttaagttttgcgccagtattagatttg
aatggcatcagcaaggtcattgggaaaagagcatttggtagtgagccggatgtggttatc
gagttggccggtagttttatcgacggcatggagcaggccggcatggcggcagtcggtaaa
cattttcctggccacggcagcgttgaagctgactctcatttcgaccaagcggtggataac
cgaaccaggcagcagattgtcgaatcagatatgcggccttttaaacaactcatcgaccag
gaaaaattgcatggagtgatgcctgctcacgttatctatcctaatatagatcctaatcct
gcaggtttttccggatattggttgaagcaggtgttgagaaatgagcttgcatttaaaggc
gtcatcttttctgatgatcttggtatggaaggggctggtgtcgtagggggctataaagcg
cgtgctcaggcggcgcttgatgcaggctgtaatatgattttactctgtaatgatgcagcc
ggtgcgactgaggtgttaaacgagttagtgtggcctgaaacgcttcctgagcggcctgcc
agtttattaaaacccaggttagatgtcgttaccaaggcgttagaggatgatgctagatgg
acaagagcaaaagagattgccggaaagtttccaattaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system