KEGG   Shewanella sediminis: Ssed_2931Help
Entry
Ssed_2931         CDS       T00596                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sse  Shewanella sediminis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ssed_2931
   00052 Galactose metabolism
    Ssed_2931
   00500 Starch and sucrose metabolism
    Ssed_2931
   00520 Amino sugar and nucleotide sugar metabolism
    Ssed_2931
Enzymes [BR:sse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ssed_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3548201..3549121
Genome map
AA seq 306 aa AA seqDB search
MKSHRIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNEAIAAGINEIVLVTH
ASKNPIENHFDTSFELEAQLERRVKRQLLSEVQSICPKGVTVISVRQSQAKGLGHAILCA
KSVVGEAPFAVLLPDVIVDEASCNLNRDNLAEMVKLFEQTDTGQIMVEGVPEDQVNQYGI
ADVNGLELQPGESKPLVQLVEKPSIDEAPSNLSVVGRYILPADIWPLLAKTPAGAGDEIQ
LTDAIAMMMEKKTVNAYYMKGKSHDCGNKQGYMQASVEHALRHKEIGTDFKNYLRKLVED
FDKDMN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatagaattcgtaaagccgttatccccgttgcgggactgggaacaaggatg
cttccggccactaaagctattcccaaagagatgctgccagtcgtcgataaacccttgata
cagtatgttgttaatgaagccattgcggccggtatcaatgagatagtattagttacccat
gccagtaaaaaccccatagaaaaccatttcgacacgagttttgagctcgaagctcagcta
gagcgccgtgttaaacgtcagctactctcagaggttcaatccatttgccccaaaggagtt
acggttatcagcgtgcgtcaatctcaggctaagggcttaggacacgccattttatgtgcc
aaatccgtcgtaggcgaggctccctttgccgtgttactgccggatgtcatcgtcgatgaa
gccagttgcaacctcaatagagacaatctggcagagatggtcaagctgtttgagcaaaca
gataccggacagataatggtggaaggcgtgccggaagatcaggttaaccaatatggtatc
gccgatgttaacgggctagaacttcaacccggagagtctaagccattggttcaactggta
gaaaaacccagtatagatgaggcaccatcaaacctttccgttgtgggccgttacatatta
cccgcagatatctggccactattggctaagacgcccgccggagccggcgatgagatacag
ttaaccgatgccatcgccatgatgatggagaagaagacggttaatgcctactacatgaaa
ggtaagagccacgactgcggtaataagcaaggttatatgcaagccagcgtcgaacacgcc
ctgcgtcataaagagattggaactgatttcaaaaattacctgagaaagctggtagaagac
ttcgataaggatatgaattaa

DBGET integrated database retrieval system