KEGG   Shewanella sediminis: Ssed_3045Help
Entry
Ssed_3045         CDS       T00596                                 

Definition
(GenBank) Protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
sse  Shewanella sediminis
Pathway
sse02020  Two-component system
sse02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ssed_3045
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ssed_3045
Enzymes [BR:sse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ssed_3045
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Ssed_3045
Two-component system [BR:sse02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ssed_3045
Bacterial motility proteins [BR:sse02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ssed_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABV37649
JGI: Ssed3045
UniProt: A8FXS6
Position
complement(3680474..3681589)
Genome map
AA seq 371 aa AA seqDB search
MGIKVLVVDDSSFFRRRVSEIVTKDPELEVIGTASNGLEAVKMAAELKPQVITMDIEMPV
MDGISAVREIMGKTPTPILMFSSLTQDGAKATLDALEAGALDFLPKRFEDIATNKDEAIL
LLQQRIKALGRRRIYRPVTRSTTPTPAKSTKTPASPQLARSVTPAPAPVRGTVVKRASGK
KYKLLLIGTSTGGPVALQKILTQLPANYPHPILLIQHMPAAFTPAFASRLNGLCKIQVKE
AQNGDQLRPGSAYLAPGGMQMMLERGGAHGRIKIVAGSADMNYKPSVDITFASASKISGR
ETMAVVLTGMGADGREGARMLKSAGATIWAQDEASCIVYGMPQAVTAAGISSQSIALDDM
AEAILRESSHG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagttcttgttgttgacgattccagtttttttcgtcgaagggtaagtgaa
attgtcactaaagatccagagctagaggtaattggtaccgcttctaatggtctggaagcc
gtaaaaatggcggcagaacttaagccacaagtgatcactatggacattgagatgcccgta
atggatggcatcagtgccgtccgtgaaattatgggtaaaacaccgacgccaattttgatg
ttttcttcattgactcaagatggcgctaaggcgacgcttgacgcgctagaagctggggca
ctcgattttcttcctaaacgcttcgaagacattgcgaccaataaagatgaggcgattctc
ttactgcaacagagaattaaggcacttggacgtagacgaatttatcgacctgtaacccgc
tctacgacaccgacgcctgctaaatcgactaaaacgccggcatctcctcagttagcccgt
tcggtgacgcccgctccggctcctgtaagaggaaccgttgttaaaagggcatcgggtaaa
aaatataaattattattgattggtacttccaccggtgggcctgtggccttgcagaagata
ttgactcaactaccggcaaattatccccatcctattttattaattcagcatatgccggca
gcctttactccagcatttgccagtcgcttaaatggactttgtaaaattcaggtaaaagag
gcacaaaatggagaccaattaagaccaggctccgcatatctggctcctggcgggatgcag
atgatgcttgagagaggtggtgctcatggtcggattaaaatcgtcgccggtagtgcagat
atgaattacaagcccagtgtcgatattacgtttgcttcagcttcaaaaatatccggaagg
gagacgatggcagtggtcttaaccggaatgggagccgatggaagagaaggggccagaatg
cttaagagtgccggtgctactatctgggcacaagatgaagccagttgtatcgtctatggt
atgcctcaagctgtgactgccgccgggatatcgagtcaatcgatagcgctggatgatatg
gccgaagctattttaagagaatccagccatggctag

DBGET integrated database retrieval system