KEGG   Shewanella sediminis: Ssed_3045Help
Entry
Ssed_3045         CDS       T00596                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sse  Shewanella sediminis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sse02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sse02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3680474..3681589)
Genome map
AA seq 371 aa AA seqDB search
MGIKVLVVDDSSFFRRRVSEIVTKDPELEVIGTASNGLEAVKMAAELKPQVITMDIEMPV
MDGISAVREIMGKTPTPILMFSSLTQDGAKATLDALEAGALDFLPKRFEDIATNKDEAIL
LLQQRIKALGRRRIYRPVTRSTTPTPAKSTKTPASPQLARSVTPAPAPVRGTVVKRASGK
KYKLLLIGTSTGGPVALQKILTQLPANYPHPILLIQHMPAAFTPAFASRLNGLCKIQVKE
AQNGDQLRPGSAYLAPGGMQMMLERGGAHGRIKIVAGSADMNYKPSVDITFASASKISGR
ETMAVVLTGMGADGREGARMLKSAGATIWAQDEASCIVYGMPQAVTAAGISSQSIALDDM
AEAILRESSHG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagttcttgttgttgacgattccagtttttttcgtcgaagggtaagtgaa
attgtcactaaagatccagagctagaggtaattggtaccgcttctaatggtctggaagcc
gtaaaaatggcggcagaacttaagccacaagtgatcactatggacattgagatgcccgta
atggatggcatcagtgccgtccgtgaaattatgggtaaaacaccgacgccaattttgatg
ttttcttcattgactcaagatggcgctaaggcgacgcttgacgcgctagaagctggggca
ctcgattttcttcctaaacgcttcgaagacattgcgaccaataaagatgaggcgattctc
ttactgcaacagagaattaaggcacttggacgtagacgaatttatcgacctgtaacccgc
tctacgacaccgacgcctgctaaatcgactaaaacgccggcatctcctcagttagcccgt
tcggtgacgcccgctccggctcctgtaagaggaaccgttgttaaaagggcatcgggtaaa
aaatataaattattattgattggtacttccaccggtgggcctgtggccttgcagaagata
ttgactcaactaccggcaaattatccccatcctattttattaattcagcatatgccggca
gcctttactccagcatttgccagtcgcttaaatggactttgtaaaattcaggtaaaagag
gcacaaaatggagaccaattaagaccaggctccgcatatctggctcctggcgggatgcag
atgatgcttgagagaggtggtgctcatggtcggattaaaatcgtcgccggtagtgcagat
atgaattacaagcccagtgtcgatattacgtttgcttcagcttcaaaaatatccggaagg
gagacgatggcagtggtcttaaccggaatgggagccgatggaagagaaggggccagaatg
cttaagagtgccggtgctactatctgggcacaagatgaagccagttgtatcgtctatggt
atgcctcaagctgtgactgccgccgggatatcgagtcaatcgatagcgctggatgatatg
gccgaagctattttaagagaatccagccatggctag

DBGET integrated database retrieval system