KEGG   Shewanella sediminis: Ssed_3298Help
Entry
Ssed_3298         CDS       T00596                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sse  Shewanella sediminis
Pathway
sse00480  Glutathione metabolism
sse00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ssed_3298
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ssed_3298
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ssed_3298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: ABV37902
JGI: Ssed3298
UniProt: A8FYH9
Position
4008210..4008695
Genome map
AA seq 161 aa AA seqDB search
MTTSIYDFSVKDIQGEAVSLSQFKGKVLLIVNTASACGFTPQYKSLQALYEKYGPDNFVI
LGFPCNQFGEQESGSEDQIQSFCELNFGVSFPLFEKIEVNGEGAHPLYQYMKSSAKGILG
SEGIKWNFTKFLIDADGKVLERYASTTKPESIEKRIISLLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatccatttatgatttttcggtcaaggatattcagggagaagcagtttcgctt
tctcaattcaaaggcaaggtactgctcatagttaataccgccagtgcttgtggtttcacg
cctcaatataaaagcctgcaggcgctctacgaaaagtatggaccagataatttcgtcata
ctggggtttccctgtaatcaattcggtgaacaagagagcggtagtgaagatcaaattcaa
tctttttgtgaattgaacttcggggtcagtttcccactgtttgaaaaaatagaggtcaat
ggcgaaggagcgcacccgctatatcaatatatgaaatcatcggctaaaggcatattgggc
agcgaagggataaagtggaattttactaaattcttaatcgatgcagacggaaaggttctc
gagcgttacgcctcaaccactaaacccgaatcgatagaaaagagaataattagtttactt
gaataa

DBGET integrated database retrieval system