KEGG   Shewanella sediminis: Ssed_3377Help
Entry
Ssed_3377         CDS       T00596                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sse  Shewanella sediminis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ssed_3377 (deoA)
Enzymes [BR:sse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ssed_3377 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4113457..4114788)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNAEALSKEEIQFFVKGITDNTVSEGQIAALGMAVYFNDMNMDERIALT
TSMRDSGTVLNWKSLDLDGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPDSALFRKVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAVDFLTGAYRNPRLYEVTMGLCAEMLQLGGIASSEAEAREKL
NRVLDNGKAAEIFGRMISGLGGPADFIENTGLYLPESKIIRPVYADQTGFASAMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTKVCALGDEISADKPIAFIHAQTENAFAEAEAAVKKA
IHVGETKPEKTPEIYRYIRESDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaagaagcgcaatgctgaggcgttgtcaaaagaa
gagattcaatttttcgttaaaggtattaccgataacacggtttcagaaggtcagatagca
gcgctgggtatggcggtctattttaatgacatgaacatggatgagcgtattgcgttaacg
acatctatgcgtgactcgggtaccgttctaaactggaaatcactggaccttgatggtcct
atcatcgataagcacagcactggcggtgttggtgatgttatcagcttgatgcttggccct
atggctgcagcatgtggcggatatgttccgatgatctcaggccgtggccttggtcatacc
ggtggaacgttagataagtttgatgctattcccggttaccaaaccgagccagatagtgca
ctgttcagaaaagtagttaaagaagccggtgtcgccattattggccagacgggcgacttg
gttcctgccgataagcgtttctactcgattcgtgataacaccgcgactgtcgagtctatc
tcactcattaccgcttcaattctctctaagaaactggctgctggcctcgatgctcttgct
atggacgttaaagtcggtagtggtgcgtttatgcctacctatgaagcatctgaagagtta
gcacgtagtatcaccgccgttgcaaacggtgcgggaactaagactacagcgctgcttacc
gatatgaaccaggtattggcttcatgtgcgggtaatgccgttgaagttaaagaagcggtc
gatttcttaacgggtgcataccgtaaccctcgtctctatgaagtgaccatgggcctatgt
gcagagatgctgcagttaggtggcatcgcttcgagcgaagctgaagcgagagagaagcta
aatcgcgttctcgacaacggtaaggcggctgagatatttggtcgtatgatctctggtctt
ggtggacctgcagattttatcgaaaatacgggtctgtatctgccagaatctaaaattatc
cgtcctgtctatgctgaccaaaccggttttgcttcggcgatggatactcgtgagctcggt
cttgcggttgttaccttaggtggtggccgtcgtaagccaggtgacgcactcgattacagt
gtcggtctgactaaagtttgtgctttaggtgatgagatttctgctgataagccaatcgcc
ttcattcatgcgcaaactgagaatgcgtttgctgaagctgaagctgcggttaagaaagcc
atccacgtaggcgagacgaaaccagaaaagactcctgaaatatatcgctatattcgtgag
tcagatctgtaa

DBGET integrated database retrieval system