KEGG   Shewanella sediminis: Ssed_3393Help
Entry
Ssed_3393         CDS       T00596                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sse  Shewanella sediminis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssed_3393
   01230 Biosynthesis of amino acids
    Ssed_3393
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssed_3393
   00051 Fructose and mannose metabolism
    Ssed_3393
   00562 Inositol phosphate metabolism
    Ssed_3393
Enzymes [BR:sse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ssed_3393
Exosome [BR:sse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ssed_3393
  Exosomal proteins of bladder cancer cells
   Ssed_3393
  Exosomal proteins of melanoma cells
   Ssed_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4135305..4136087)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLALELFNKFATKLQDDSAEVVLCPPSIYLESVRQQLDANKD
ALNGCLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPYIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNSTEFLSLCSIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtccaatggtcgctggtaactggaaaatgaatggcagtgcgcaatta
gcgctggagttattcaataaattcgctactaagcttcaagatgattcagcggaagtggtc
ttatgcccaccaagcatatatctagaaagtgtacgtcagcagttagacgctaataaagac
gctttaaatggttgtcttgtcagaatgggcgcacaaaacctgagtcaacatgacttcggt
gcttatactggtgaagtgtcagggcagatgttaaaggattcaggatgccgatatgttatt
atcggacactccgaacgtcgccgtatgtacggagagacgagtgatatcgttgctgagaag
tttgcagcagcacaaaaacatggtttgaccccaatactttgtgttggtgagtccggtcca
gctagagaagcgagaagaacttttgaagttatcgccgaagagttagatgtggtcattgaa
aaaaatggcaccatggcatttgataacgcgattatcgcctatgagcctttatgggctgta
ggaaccggtaagagtgctacgccagagcaggcacaggaagttcatgcgtttatacgcaaa
cgcctctctgaagtgtctccatatattggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaatgctgcagatctatttgcacaacctgatgtagatggtggattgatt
ggcggtgtgagcttaaactctaccgagtttctaagtttatgttccatagcgatgagcgca
taa

DBGET integrated database retrieval system