KEGG   Shewanella sediminis: Ssed_3393Help
Entry
Ssed_3393         CDS       T00596                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sse  Shewanella sediminis
Pathway
sse00010  Glycolysis / Gluconeogenesis
sse00051  Fructose and mannose metabolism
sse00562  Inositol phosphate metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01130  Biosynthesis of antibiotics
sse01200  Carbon metabolism
sse01230  Biosynthesis of amino acids
Module
sse_M00002  Glycolysis, core module involving three-carbon compounds
sse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssed_3393
   00051 Fructose and mannose metabolism
    Ssed_3393
   00562 Inositol phosphate metabolism
    Ssed_3393
Enzymes [BR:sse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ssed_3393
Exosome [BR:sse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ssed_3393
  Exosomal proteins of bladder cancer cells
   Ssed_3393
  Exosomal proteins of melanoma cells
   Ssed_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV37997
JGI: Ssed3393
UniProt: A8FYS4
Position
complement(4135305..4136087)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLALELFNKFATKLQDDSAEVVLCPPSIYLESVRQQLDANKD
ALNGCLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPYIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNSTEFLSLCSIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtccaatggtcgctggtaactggaaaatgaatggcagtgcgcaatta
gcgctggagttattcaataaattcgctactaagcttcaagatgattcagcggaagtggtc
ttatgcccaccaagcatatatctagaaagtgtacgtcagcagttagacgctaataaagac
gctttaaatggttgtcttgtcagaatgggcgcacaaaacctgagtcaacatgacttcggt
gcttatactggtgaagtgtcagggcagatgttaaaggattcaggatgccgatatgttatt
atcggacactccgaacgtcgccgtatgtacggagagacgagtgatatcgttgctgagaag
tttgcagcagcacaaaaacatggtttgaccccaatactttgtgttggtgagtccggtcca
gctagagaagcgagaagaacttttgaagttatcgccgaagagttagatgtggtcattgaa
aaaaatggcaccatggcatttgataacgcgattatcgcctatgagcctttatgggctgta
ggaaccggtaagagtgctacgccagagcaggcacaggaagttcatgcgtttatacgcaaa
cgcctctctgaagtgtctccatatattggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaatgctgcagatctatttgcacaacctgatgtagatggtggattgatt
ggcggtgtgagcttaaactctaccgagtttctaagtttatgttccatagcgatgagcgca
taa

DBGET integrated database retrieval system