KEGG   Shewanella sediminis: Ssed_4018Help
Entry
Ssed_4018         CDS       T00596                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sse  Shewanella sediminis
Pathway
sse00052  Galactose metabolism
sse00511  Other glycan degradation
sse00600  Sphingolipid metabolism
sse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ssed_4018
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ssed_4018
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ssed_4018
Enzymes [BR:sse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Ssed_4018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 Phe_hydrox_dim
Motif
Other DBs
NCBI-ProteinID: ABV38622
JGI: Ssed4018
UniProt: A8G0J9
Position
4919430..4922609
Genome map
AA seq 1059 aa AA seqDB search
MSKSITLVSTLLLGLCSLTSQATERWQDHSVFEVNKEPPHASFFAYDSILKASADNYRSS
KNFMDLNGTWQFHYAPNPASVPVDFANNSYDPTNWGSIQVPGNWETQGYGHAIYLDERYP
FTTSWPDAPQDHNPTGSYRREFTQPEDWQGKQIFFHVGAARSSLTLFVNGAEVGYSQGAK
TPAEFNITQYLKPGKNLLSMKIIRWSDASYLESQDMLRMSGIERDVYLFATPQQRISDID
ALYSLNNKLDKAELALSFKLKNHQATAPVTVDYQLLSPAGELVANGSQSLILKGDNSVIF
EDKLVSPLLWSAETPELYQLIVSMKDDKGKLLQASSQHIGFRHIEIKAGQLLINKRAITI
RGVDRHETDPLTGHVVSRESMERDIRLMKLNNINAVRSSHYPNDPYWLQLADRYGMYIVD
EANIESHPLAIDEKTQLGNEMSWYPAHLARVERMLERDKNHPSVIIWSLGNEAGEGKLFE
QLYRWVKQRDSSRPVQYEPAGMAAYTDIVAPMYPSIERIETYAKAHTDRPLIMIEYAHAM
GNSVGNLQDYWDVIEKYPNLQGGFIWDWVDQSLKFTNEKGEDYWAYGKDYHPDMPTDGNF
LNNGLVDPDRNPHPHLSEVKKVYQAIGFDNFKFNGNFDDNLDDKSASIRLTNKYDFQSTK
GLTLSWSLQKDGIAVASGSEPMPVIAAGEAKSVTIKLTNKPALVFDSRYEYRLLVSVSLA
EPRPLIPAGHELAFAQYLLLEASPNISPVSTATSLAETETRWQLSHGDNHYSISQISGWL
TEIEIDGEPQIQAPLMANFWRAPTDNDLGNGMPDWGGVWQDASAQLTLESIEPLEEHGLI
VTHQHPKLGITLVTQYRVNKRGELMVNISFNPGKTALPDLPKFGFTTRLPFEQRYLSYYG
RGPEETYADRASGNPFGWYQLPIEKLFHRYSRPQETGQRTQIRYAAVRNSAGTGLMAVAQ
NEMQTSLWPFSLADIDFREGDAQGSASGLVPVTQNHGGEVPIRDFVTWNIDLKQMGVGGD
TSWGRPVHDKYRIKAEKMSFKFRLVPVTAQSQLQQLARE
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatccatcaccctagtcagcactctactactcggcttatgcagtctcacctcc
caagcaactgagcgatggcaggatcactcggtatttgaggtcaataaagagcctccacac
gccagcttcttcgcctatgactcaatcctgaaggcgagtgccgacaattatcgaagtagc
aaaaacttcatggatctcaatggtacatggcagtttcattatgcgcccaaccctgcatca
gtccctgtagactttgcaaacaacagctatgatcccacgaactggggcagcattcaggtt
cccggtaactgggagactcaaggttacggtcatgccatctacctcgatgagcgctacccc
ttcaccaccagctggcccgacgccccccaagatcataatccgacgggcagttatcgacgc
gaattcacccagcccgaagattggcaaggcaaacagattttcttccatgtgggcgccgca
agatcctcactgactctatttgttaacggcgcagaggttggctatagccagggtgctaag
acgccggccgagtttaatattactcagtacctcaagccgggtaaaaacctgctttcgatg
aagataattcgctggagtgatgccagttatctggaaagccaggatatgcttcgaatgagc
ggcatcgagcgtgatgtctacctctttgccacacctcaacagaggatcagcgatattgat
gcactctacagtctcaataacaaattagataaggccgaactggcattaagcttcaagcta
aaaaaccatcaagctacagcgccagtcacggttgattaccaattactttcaccggccgga
gagttggtggcaaacggcagccagagcctgatattgaagggggataacagcgtcattttc
gaggataagctggtatcaccattgctgtggagcgccgaaacaccagagctctaccaactt
atcgtcagcatgaaagatgataaaggcaagttgttgcaggccagtagccaacatataggt
tttcgtcatatagagattaaagcggggcaattgttaatcaataagcgggccatcaccatc
cgtggtgtcgaccgccatgaaaccgatcctcttaccggtcatgtcgtcagccgtgagagc
atggagcgagatatccgcttgatgaagttaaacaacatcaacgccgttcgctcatctcac
tatcctaacgatccatactggctccagctggccgacagatacggcatgtatatcgtcgat
gaagccaatatcgaatctcatcccctcgccatcgatgaaaagacccaactcggtaacgaa
atgagttggtatccggcccatctggcccgcgtcgagcgcatgcttgaacgggataagaac
cacccatcggtgatcatctggtctctgggtaacgaggccggcgaaggaaaactgtttgaa
cagctctatcggtgggtcaaacagcgcgattccagtcgtccggttcagtatgaacccgct
ggcatggccgcctataccgatattgtcgcccctatgtatccctccattgagcggatagaa
acgtacgccaaagcacataccgaccgaccactgatcatgattgagtatgcccacgccatg
ggcaactcggttggcaaccttcaggactactgggatgtcatagaaaagtatccgaacctg
caaggcggctttatctgggactgggtggatcaatcgctaaagttcaccaatgaaaaggga
gaagattattgggcatacggaaaggattaccacccggatatgcccacagacggtaacttt
ctcaataatggtttagtcgatccggaccgaaatccgcaccctcacctgagtgaagtaaag
aaggtctatcaagccatagggttcgataatttcaaattcaatggcaatttcgatgacaat
ctcgatgacaagagtgccagtatcaggctaaccaacaaatatgactttcaaagcactaag
ggactgacgctgagctggtcgctgcaaaaagatggcatagccgtcgcgagtggcagcgag
cctatgcccgtgatagcggccggtgaagctaaatctgtcactatcaagctcacaaacaag
ccagcgcttgtattcgatagcagatacgaataccggctactcgtttcggtttcactggcg
gagcccagacctttgatccccgcaggtcatgagttggcatttgcacaatatttactgctg
gaagccagcccaaacatctcgccagtgagcacggccaccagcttggcggagactgagact
cgatggcaactcagccacggggataaccactattcaatatcccaaatttccggctggtta
accgagatagagattgatggtgaaccgcagatccaggcccccttaatggccaacttctgg
cgagctcccacggataatgacttaggtaatggtatgcccgactggggaggtgtatggcaa
gatgcctcggctcaactcacccttgagtccatcgagcctctcgaggagcacggcctgata
gtgacccatcagcatcccaagttaggtatcaccttagtgacacaataccgtgtaaataag
cgtggcgaactcatggttaacataagctttaatccaggcaagaccgcccttccggatctg
cccaagtttggctttacgactcgccttcccttcgaacagcgttacctgagttattacgga
cgcggccccgaagagacctatgcagacagagcttcaggtaatcctttcggttggtatcaa
ctgccgatagagaaattatttcaccgttattcacgtccccaggagaccgggcagcgaacc
cagatcagatatgcagcagtcagaaacagtgctgggaccggtctgatggccgtagcccaa
aacgagatgcaaaccagtttatggccctttagtctggctgatatcgactttagagagggt
gatgcgcagggctcggcatcgggcttagtcccggtgacacagaaccatggcggtgaggtc
cccattcgtgattttgtcacctggaatatagacctgaaacagatgggagtcggtggcgat
acctcatggggtcgccccgtacatgacaagtacagaattaaggccgagaagatgagtttc
aagttcaggctcgtccccgtaacggcgcagagccaacttcaacaactggcccgagagtaa

DBGET integrated database retrieval system