KEGG   Shewanella sediminis: Ssed_4021Help
Entry
Ssed_4021         CDS       T00596                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sse  Shewanella sediminis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sse00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sse00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4925581..4926600
Genome map
AA seq 339 aa AA seqDB search
MVRFRPLDPWDDPRGGQIERVRIDNGILALEVLSLGGIIRSLWTPDRNGERGNIVLGCDS
AEDYLTQDAHLGAVAGRYANRIANGQMTFDGEHYYLDKNQANNCLHGGREGFNRKQWNIG
QLPDGVRLSLVSPDGDMGFPGNCNIQVDYRLVANNLYVEMFAATDRACPLSMTQHSYFNL
EGSRSGGNGNHRLQIDSTEYLETNSTGIPNSIIAGADSNLDFRKSKTLASKLKDTDGLDH
CYLMRNNDKELLRFGNLSAPESGRCMTLYTNQPGVQVYGANFLEGNPGRNEQKLKRHQAV
CIEPQQLPDAPNQTELLGDPWIKPGQIYHHISRYQFETF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggtacgttttcgtccgctggatccctgggatgatccccgtggtggtcaaattgaacgt
gtcagaatagataatggcatcttagccctggaagtattaagcctgggcggcatcatccgc
tctctgtggacaccggataggaatggcgaacgcggcaacatagttctgggttgtgactcg
gccgaagattatctaacccaagatgctcatttaggcgctgttgccgggcgttatgcaaat
agaattgctaacgggcaaatgacattcgatggtgagcattattacttagataaaaatcaa
gcgaataactgcctgcatggcggccgggaaggcttcaatcgaaagcagtggaacataggt
cagcttcccgatggtgttcgcttgagtctggttagccccgatggtgatatgggattcccc
ggcaactgtaacattcaggtcgattaccgtctggtggcgaataacctctatgtagagatg
tttgccgccacagacagagcctgcccgctcagcatgactcagcatagctactttaacctg
gaggggagtcgctccggcggcaacggcaaccaccgtctgcaaatcgatagcactgaatat
ttagaaactaactcaaccgggatccccaacagtatcatagcgggggctgacagtaacttg
gacttcaggaagtctaaaaccctggcgagcaagctcaaagatactgatggattagaccac
tgttatcttatgagaaataacgataaagagctgcttcgtttcggtaaccttagtgccccc
gaatctggtcgctgcatgacactctataccaatcagccgggagttcaggtctacggtgcc
aactttctggagggtaacccgggccgtaatgagcagaaattgaagcgtcatcaagcggtc
tgtatcgaacctcaacaactccccgatgcgcctaatcaaactgagttacttggcgatccc
tggataaaacccggtcagatttatcatcatatcagtcgctaccaattcgagacattttaa

DBGET integrated database retrieval system