KEGG   Shewanella sediminis: Ssed_4105Help
Entry
Ssed_4105         CDS       T00596                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sse  Shewanella sediminis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ssed_4105
Enzymes [BR:sse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ssed_4105
Exosome [BR:sse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ssed_4105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5020015..5021031
Genome map
AA seq 338 aa AA seqDB search
MNIITSAFPQRRMRRMRKHDFSRRLMAENQLSVNDLIYPMFVLEGNNRTEEIASMPGVER
YSIDLLLKEAEEIVKLGIPLIALFPVTPSEKKTLMAEEAYNADALAQRAVRALKEAFPEL
GVMTDVALDPFTTHGQDGIIDEDGYILNDITTEILVKQALSHAEAGADIVAPSDMMDGRI
GAIRQALEEAGHVNTQIMAYSAKYSSNYYGPFRDAVGSAGNLKGGNKHSYQMDPANSDEA
LHEVALDIQEGADMVMVKPGMPYLDIVTRVKRELAVPTFAYQVSGEYAMHMAAIENGWLA
EKAIVMESLLCFKRAGANGVLTYFAKRAAQWLKEDEVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattattactagtgctttccctcagcgtagaatgcgccgcatgcgtaaacatgac
tttagccgtcgtttaatggctgaaaaccagctttcggtgaatgatttaatctaccctatg
tttgtattagagggtaacaatcgtaccgaagagatcgcttctatgccgggggttgaacgc
tactctatcgatcttttgcttaaagaagccgaagagatcgtcaagctgggaatcccgctg
attgcacttttcccagtgactccgagtgaaaagaaaaccctcatggccgaagaggcttat
aacgccgatgctctggcgcaacgtgcggttcgtgcactcaaggaagccttccctgagctg
ggtgtcatgactgacgtcgccttagacccattcacgactcatggtcaagatggcatcatc
gacgaagatggctatattcttaatgacatcactaccgaaatattagttaagcaggcgctg
tctcatgccgaagcgggtgccgacattgttgccccatccgatatgatggatggtcgtatc
ggtgcgattcgccaggcactcgaagaagccggtcatgtgaacactcagatcatggcatac
tcggctaagtattcatcaaactattacggaccatttcgtgatgccgtcggctctgcgggt
aacctaaagggtggtaataaacacagctaccagatggatccggcaaatagcgatgaggct
ttacatgaggttgccctcgatattcaggaaggtgcagatatggtcatggttaagcctggc
atgccttacctcgatatcgtaacccgggttaaacgagagcttgccgtaccaacattcgcc
tatcaggtcagtggtgaatatgccatgcatatggctgccatcgagaatggctggttggcc
gaaaaagccatcgttatggagtcgctactctgctttaagcgtgccggcgcaaatggcgtc
ctgacttacttcgctaagcgagctgctcagtggctaaaagaggatgaagtgaagtaa

DBGET integrated database retrieval system