KEGG   Shewanella sediminis: Ssed_4134Help
Entry
Ssed_4134         CDS       T00596                                 

Definition
(GenBank) uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sse  Shewanella sediminis
Pathway
sse00860  Porphyrin and chlorophyll metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ssed_4134
Enzymes [BR:sse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ssed_4134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 FlgT_N YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: ABV38738
JGI: Ssed4134
UniProt: A8G0W5
Position
5053183..5053917
Genome map
AA seq 244 aa AA seqDB search
MKVLLTRPQGRNQSMIEALNEKGVSHVVTPLLNVQATDIQLHQSSIEQFNQADIVIFIST
NAVKFASKALNNQFPDSAQFYAVGEATYQALLALGISSQKAPQECQQTEGLLTLEQLHHI
SNKNIVIVRGVGGREALAEALTSRGAIVNYWEAYQRGCPQLDKNSVIQGWQNAEIDTIVV
TSGEILNNLIKLVPKELFAWLRACHIIVPSSRVQEQALANGLQHVTNAKAANCKAVLSAL
KLSI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacttctgacgcgcccacaagggcgtaatcagtcgatgatagaggccctgaat
gaaaaaggggtctctcatgtcgtcacgccattattgaatgttcaagcaactgatattcag
ctgcaccaatcatctatcgaacaatttaaccaagctgatattgtgatttttatcagcact
aatgcggtaaaattcgcttctaaagcattaaataaccaatttccagactctgcacagttt
tatgccgttggagaagcaacctatcaggctctcctagcccttgggatctcttcccaaaaa
gcgccacaggaatgccaacagaccgaagggttactcactctcgaacagcttcatcatatt
tcaaataagaacattgtgatcgtacggggcgtcggaggaagagaggcactggccgaggca
ctaacctctcggggggccatcgtcaactattgggaggcctatcaaaggggttgcccacag
ctagacaaaaacagtgttattcaggggtggcagaacgctgaaatagacacgattgtcgtc
accagtggcgaaatacttaataatctaatcaaacttgtaccaaaagagctatttgcttgg
ctgcgtgcatgtcatattatagtccctagctctcgagttcaggaacaagccttagccaac
ggattacaacacgttactaatgccaaagctgcaaactgcaaggccgtactatcagcctta
aagttatctatctag

DBGET integrated database retrieval system