KEGG   Shewanella sediminis: Ssed_4265Help
Entry
Ssed_4265         CDS       T00596                                 

Gene name
aroK
Definition
shikimate kinase I
Orthology
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
sse  Shewanella sediminis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssed_4265 (aroK)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssed_4265 (aroK)
Enzymes [BR:sse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Ssed_4265 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5234834..5235349)
Genome map
AA seq 171 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLDFHDSDQEIESRTGADIAWVFDVEGEEGFR
VRETQVVADLTEKQGIVLATGGGSIQSKEIRNNLSARGIVVYLETTIDKQVARTQRDKRR
PLLQVDDPREVLENLAATRNPLYEEIADVIVKTDEQSAKVVANQIIEQLGF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgaaatattttcctcgtaggccctatgggggctggtaaaagcactata
gggcgtcatctagcgcagatgctgcacctagatttccacgattcagatcaagaaattgaa
agccgcactggtgcggatatagcgtgggtttttgatgtcgaaggcgaagaaggtttccgc
gttcgtgaaacacaagtagtcgctgatttaactgaaaaacaaggtattgttttagcgaca
ggcggtggttctattcagagtaaagagattcgtaataacctctctgctcgtggaattgtc
gtatatctagaaactacaatcgataagcaagttgctcgtactcaacgagataagcgacgc
ccattattgcaggtagacgatccaagagaagttttggaaaatctggctgcgactcgtaat
cctttgtacgaagagattgcagatgtcatcgtaaagactgatgagcaaagcgccaaagtg
gttgcgaatcaaattattgaacagttaggtttctag

DBGET integrated database retrieval system