KEGG   Shewanella sediminis: Ssed_4340Help
Entry
Ssed_4340         CDS       T00596                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sse  Shewanella sediminis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sse01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sse01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5316987..5318105
Genome map
AA seq 372 aa AA seqDB search
MNTPPLIWTNVLLFAITFLGAAIFVPWYGILQGYGLIEWLAFIGFAFASGLSITAGYHRL
WSHKTYKASSSVRFIFALGGALALQNSALHWSSDHRVHHKHVDNNDKDPYSAKMGFWYSH
IGWMLREYQAQRYHDYKNVRDLQNDKIVMWQHKYYLALVLLMNIALPAFLGWLNGDILGM
LLMAGLLRLVVVHHCTFFINSLAHVWGSQPYTDKNTARDNGIIALLTYGEGYHNFHHIFE
NDYRNGIKWWQYDPTKWLINLLNWLGLAKDLRVTPQERVESAMLQMQLKRTQRRVANLTN
CDEALEKLQAEYELLKSHLADYYKAKKELLEAKRKQLASKQLMLQVEEMKQRFLAQQKNW
QMLTSTYAQPIK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaccaccgttaatttggaccaatgtgctgctatttgccatcacatttcttggt
gccgcgatctttgtcccttggtatgggatcctacagggctatggcttaattgaatggcta
gcctttattggttttgcttttgccagtggcctatctattaccgccggataccatagactc
tggtcacacaaaacgtataaagccagttcatctgtacgctttatctttgccttggggggg
gcattagcattgcaaaatagtgcccttcattggtcttccgatcatcgtgttcaccacaaa
catgtcgataacaatgacaaagatccctattcagccaaaatgggattttggtatagccac
ataggttggatgttaagagagtaccaagcacagcgttatcacgattataaaaatgttcgt
gacttacaaaatgacaagattgtcatgtggcagcacaaatactacttagcattagtgctt
ctgatgaatattgctctgcccgcatttcttggctggctcaacggtgacatactgggcatg
ctcctgatggcgggtttgttaaggctcgttgtcgttcatcactgtacattcttcattaat
tcactggcgcatgtctggggaagtcagccctacacagataaaaataccgccagagataac
gggatcattgcccttctcacctatggcgagggctaccataactttcatcatatctttgaa
aatgattatcgaaatggcattaagtggtggcaatacgatccaaccaaatggcttatcaat
ttgcttaactggctgggtttagcaaaagatctacgtgtcacacctcaagagagagttgag
agcgccatgttacagatgcaacttaagcgaactcagcgtcgagttgcaaatctaactaac
tgcgatgaggcgttagaaaagcttcaggctgaatatgagctgttaaagtcgcacctggca
gattattacaaggcgaagaaagagcttttggaagcgaagcgcaaacaactggccagcaag
caactgatgttgcaggttgaggagatgaagcaacgtttccttgcccagcaaaagaactgg
caaatgctgacgtcgacttacgcgcagccaataaaatag

DBGET integrated database retrieval system