KEGG   Streptococcus suis A7: SSUA7_0164Help
Entry
SSUA7_0164        CDS       T02020                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssf  Streptococcus suis A7
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSUA7_0164
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSUA7_0164
   00600 Sphingolipid metabolism
    SSUA7_0164
Enzymes [BR:ssf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSUA7_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157877..160078
Genome map
AA seq 733 aa AA seqDB search
MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETASYQYVREDEYRALTSF
VEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFVYQGHAIYAGRSALKGL
PHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAVTRSARFEQLGEKSVCLNRAL
SMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLKGASSAEHNPFMALKRPTA
DEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERFSWTLDKGEEFQTPEVVMVY
SEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAMSFDFDEETILSLAKEAAGLG
VELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGIIDQVHAMGMKFGLWIEPEMVNR
DSELYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQNIHDQLHRLLAEHDIDYIKWDM
NRYMTEVFTCTREADRQGETFHRYILNLYRLYDSLIAAFPTVLFESCSSGGARFDPGMLY
YAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHVSASPNQQLGRATPLNTRANVAFFG
SFGYELDLFECSQEELEEMKEQIAFYKTHRKIFQQGIFTRLKSPFDGEITAWQVQSSDGQ
QVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNK
DFTSCLMVLQKQQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatctttcatgaaaagacaaaggaattccatctttacaatgagtttattagc
tatgtgttgacggtcttgcctaatggtcatattggtagtttgtattatggaaagcgtgta
acagaaacagcttcttatcagtatgtacgtgaagatgagtatcgtgctttgacttccttt
gtagaagacgatgaccgtttcttttcgctccaatatgccaatcctgaatttgcttgttat
ggtacaacggactatttttctccgacttttgagttggtgcagaaggatggtagcagtcta
tcgcactttgtgtatcaaggtcatgcgatttatgctgggcgatcggctttgaagggtctt
cctcatctctatctggatgaggagggacaggcagatagtttggatatttatttgttggat
gaagattcgcagacccggctggtcttgtcttatacgatttttcgagattatccagcggtg
actcgctctgctcgttttgaacaactcggagaaaaatctgtctgtttgaaccgtgccttg
agtatgacactttgtctgcctgatatggactatgattggttgcatttggatggggcttgg
gggcgtgagcggcatctgcaactatcgcctcttcatcaaggttgtcagtctatttacagt
ctcaaaggggctagtagtgcggagcacaatccctttatggctttgaaacgcccaactgcg
gatgagcaacagggagaggtactaggcttctcgctcgtctatagcggaaactttttggcg
caggtggatgtgagttctttccaaaaaacaagagtgagtatgggaatccatcctgagcgt
ttttcttggacattagataagggagaagagttccagacgcctgaggttgttatggtttat
agcgagcatggtttgaatggcatgagccaaacctatcaccgcctcttccaaaaacatctg
gtacgtggctattggcgtgatagagaacgacctgttctcttgaataactgggaagccatg
agttttgattttgatgaggaaacaattctttccttggccaaagaggctgcaggtcttggt
gttgaactctttgtcatggatgatggttggtttggcaagcgaaaccatgaccgagcaggc
ttgggagattggacggtcaaccgagagaaattaccaagtggcttgacagggattattgac
caagttcatgctatgggaatgaaatttggactttggatcgaacctgaaatggtcaatagg
gacagcgagctttaccgagcgcatccagactggattttccatcatcctcagcatagtcaa
tcgcacggacgccaccaatatacgctggatttgtcgagggaggatgtttatcaaaatatt
catgaccaactccatcggctgttggctgagcatgatattgattatatcaagtgggacatg
aatcgctatatgacagaggtctttacatgtacacgggaggcggatcgacaaggtgagacc
ttccatcgctatattctcaatctctaccgtttatatgatagcctgatagcagcttttccg
acagtcttattcgaatcttgttcaagtggtggagctagatttgatccagggatgctctac
tatgcaccgcaaacctgggtcagcgatgacacggacgccatggaacgcttgaaaatccaa
tatggaacgagcatggtctatcctttgaatagtatgggttgccatgtgtcagctagtcca
aatcagcagttggggcgtgctactccactaaacacacgtgccaatgttgcattctttgga
agttttggctatgaattggatttgtttgagtgtagccaagaagagttggaagagatgaaa
gagcagattgccttttacaagactcaccgtaagattttccaacagggtattttcactcgt
ctgaaaagtccattcgatggagaaataacggcttggcaggtccaatcctcggatggtcag
caagtcatcgtgggttattatcgtcggttgacaacggctaatctctcctatcaacgcttg
tatttgcagggattggaagaggaagcggtctatcaccttgatggagaagtttatactggt
agccaattaatgcatacaggtttgtcgattcgacatggggaccatgttggagacaataag
gactttacttcttgtttgatggtccttcagaaacaacagtag

DBGET integrated database retrieval system