KEGG   Streptococcus suis A7: SSUA7_0262Help
Entry
SSUA7_0262        CDS       T02020                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ssf  Streptococcus suis A7
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSUA7_0262
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_0262
   00620 Pyruvate metabolism
    SSUA7_0262
   00650 Butanoate metabolism
    SSUA7_0262
  Lipid metabolism
   00071 Fatty acid degradation
    SSUA7_0262
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUA7_0262
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUA7_0262
   00626 Naphthalene degradation
    SSUA7_0262
Enzymes [BR:ssf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUA7_0262
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SSUA7_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268590..271241
Genome map
AA seq 883 aa AA seqDB search
MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYIVAKASVAALDKHGEL
AMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARVVYEAAVAAGAPENCIQW
VTKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYKTYFVNKKEKALLEEYCFGV
KANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILAAEVAEIGEKEPLTREKLSPV
IAVLKVEGRAEGLEAARQMVEFHGLGHSAAIHTEDAELAKEFGTIVRAIRVIWNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIKKVGRRRNNMQWFKVPSKTYFER
DSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLDLRRNKVVYQIFSDVEPDPDITTV
YKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPTVDFHDLVQKFMDIRKRAFKFPE
LGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPAH
VTADTGMDVLTHATEAYVSTVANDFTDGLALQAIKLVFENLESSVKNADFVSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGGRFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YKADEKYQDIARLLGLPCSTPEEAVAAYAQAVYDLGERIGIQMNLKAQGIDEKELKEHSR
ELALLAYEDQCTPANPRLAMVDHMQEIIEDAYYGYKERPGRIK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaagtagtatcaccagaagaaaagttggtagaagcgcgcaagcacgtc
gatgagcttgttcaaaaaggtttggttgctcttgatgagttccgtaaacttggtcaagaa
gaagtagactatattgtagcgaaagcttcggttgcggcccttgataaacatggcgaattg
gcaatgcacgcctttgaagaaaccaaacgtggtgtattcgaagacaaggctactaagaac
ttgtttgcctgtgagcacgttgtcaataacatgcgccatacaaaaacagttggtgtcatc
gaggaagatgatgtaacaggtttgactttgattgctgagccggtcggtgttgtttgtggt
atcacaccaacaacaaacccaacttctacagcaatctttaaatcattgattgccttgaag
acacgtaatccaattgtctttgccttccacccatctgcgcaagaatcttctgctcatgca
gctcgtgttgtctatgaagcagctgtggcagctggtgcccctgaaaactgtatccagtgg
gtaacaaaaccatctatggaagcaacgtctgagttgatgaaacatgatggtattgcaaca
atccttgcaactggtggtaacgcaatggtgcgtgcagcttactcttgtggtaaacctgcc
cttggtgtaggtgcaggtaacgttccagcctatgttgaaaaatcagcaaacatccgtcag
gcagcacatgacatcgttatgtctaagtcatttgacaacggtatggtctgtgcgtcagaa
caagcggttatcattgataaagaagtttacgatgagtttgtagcagaattcaaatcttac
aaaacttacttcgttaataagaaagaaaaagctcttcttgaagaatactgcttcggtgtg
aaagctaacagcaaaaactgtgctgaaggtaaattgaacgcagacatcgttggtcgccca
gctgcatggatcgctgagcaggccggcttctcagtaccagaaggtacaaacatcttggca
gctgaggttgctgaaatcggtgagaaagaaccattgactcgtgagaaattgtcacctgtt
attgccgtcttgaaagttgaaggtcgtgcagaaggtcttgaagcagctcgccaaatggtt
gaattccacggtctcggtcactctgcagctattcatacggaagacgcagaattggcgaaa
gagtttggtacaatcgtacgtgctatccgtgttatttggaactctccatctactttcggt
ggtatcggtgatgtttacaacgcattcttgccatcattgacacttggttgtggttcttac
ggacgcaactcaatcagtgataacgtaagtgctatgaacttgctcaacatcaagaaagta
ggaagacgtagaaataatatgcaatggtttaaagttccttctaaaacatacttcgaacgt
gactctatccaatatctccaaaaatgccgtgacgttgaacgtgtcatgatcgttacagac
cgtgccatggtagaacttggattcctagatcgtatcatcgaacaattggaccttcgtcgt
aataaagttgtttatcaaatcttctcagacgttgagccagatccagacatcacaacggtt
tataaaggtacagaattgatgcgtaccttcaaaccagatacaatcatcgcactcggtggt
ggttcaccaatggatgctgccaaagttatgtggctcttctacgaacaaccaacagttgat
ttccatgacctagttcaaaaattcatggatatccgtaaacgtgccttcaagttcccagaa
cttggtaagaaatctaagtttatcgcgattccaactacctcaggtacaggttcagaagta
acaccgttcgccgtaatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgttgacccagcactcgtattgacagtacctgcacac
gttacagcagatactggtatggacgtattgactcacgctacagaagcatacgtttcaaca
gtagctaacgactttacagatggtttagcacttcaagctatcaaactagtatttgaaaac
cttgaaagctcagtgaagaatgctgactttgtatcacgtgagaaaatgcacaacgcatca
actatggcaggtatggccttcgccaacgcattcctaggtatttctcactcaatggctcat
aagattggtggacgtttccataccgttcacggtcgtacaaacgctatcttgcttccatac
gttatccgctacaacggtactcgtcctgccaagacagctacatggcctaagtacaactac
tataaagcagatgaaaaataccaagacatcgcacgtcttctaggcttgccatgctcaaca
ccagaagaagctgttgcagcatacgcacaagcagtttacgacctcggtgaacgcatcggt
atccaaatgaatttgaaagcacaaggtatcgacgagaaagaactcaaagaacactctcgc
gaattggctcttcttgcctacgaagatcaatgtaccccagctaacccacgtctagcaatg
gttgaccacatgcaagaaatcatcgaggatgcctactacggttacaaagaacgtccaggt
cgcatcaagtaa

DBGET integrated database retrieval system