KEGG   Streptococcus suis A7: SSUA7_0498Help
Entry
SSUA7_0498        CDS       T02020                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssf  Streptococcus suis A7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUA7_0498
   01230 Biosynthesis of amino acids
    SSUA7_0498
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_0498
   00030 Pentose phosphate pathway
    SSUA7_0498
   00051 Fructose and mannose metabolism
    SSUA7_0498
   00052 Galactose metabolism
    SSUA7_0498
  Energy metabolism
   00680 Methane metabolism
    SSUA7_0498
Enzymes [BR:ssf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSUA7_0498
Protein phosphatases and associated proteins [BR:ssf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSUA7_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529325..530335
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAEGVMPAAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattgaaaaaacatggtatcgaaggtgtagttgttatc
ggtggtgatggttcttaccacggtgcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtacaattgataacgacatcgtgggtacagattttacaatcggttttgat
acagctgtaacaactgctatggatgcgattgataaaatccgcgatacttcatcaagtcac
cgtcgtactttcgttgttgaagtaatgggacgtcatgcgggagacatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
gttgttgatcgcattaaagcgggctacgataaaggtaagaaacatagcatcattgtcttg
gccgaaggtgttatgccagcggcacagtttgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcggtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system