KEGG   Streptococcus suis A7: SSUA7_0672Help
Entry
SSUA7_0672        CDS       T02020                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssf  Streptococcus suis A7
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSUA7_0672 (glpK)
Enzymes [BR:ssf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SSUA7_0672 (glpK)
Exosome [BR:ssf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUA7_0672 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
705103..706617
Genome map
AA seq 504 aa AA seqDB search
MSTEKYIMAIDQGTTSSRAIIFNKKGEKVGSYQKEFTQIFPKPGWVEHNANEIWNSVQSV
IAGSFIESGVRPDQIEGIGITNQRETTVVWDKETGLPIYNAVVWQSRQTAHIADQLKADG
HADMIHQKTGLVVDAYFSATKVRWILDQVPGAQERAEKGEILFGTIDTWLVWKLTDGKCH
VTDYSNAARTMLYNIEELKWDDEILSLLNIPKAMLPEVRSNSEVYGTTAPFHFYGAEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIVMNTGEEMQLSQNNLLTTIGYGIGGKVY
YALEGSIFIAGSAVQWLRDSMRMVTTSPESEELARKSTSNDEVYVVPAFTGLGAPYWNSD
ARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQLDTGIDISVLKVDGGAAMNSLLM
QFQADILGIEIARAQNLETTALGAAFLAGLAVGFWKDLDELKELNAVGQSFQPTMNEARK
EQLYKGWKKAVAATQLFAEVDEEQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaaaaatatatcatggccattgaccaaggaactacaagttcacgtgccatt
atcttcaataaaaaaggtgaaaaggttggcagttaccaaaaagagtttacgcaaattttc
cctaaaccaggttgggttgaacacaacgccaatgaaatttggaattctgttcagtctgtg
attgcagggtcctttatcgaaagcggtgttcgtcctgatcagattgaaggaattggtatt
accaaccagcgtgaaacaaccgttgtctgggataaggaaacaggtcttccaatctacaat
gccgttgtctggcaatctcgtcaaacagctcatattgctgaccagctgaaggcggatggt
catgcagatatgattcatcaaaagacaggtctagtagtcgacgcctacttctcagcaacc
aaagttcgttggattttagatcaagtccctggagcgcaggaacgtgctgaaaaaggtgag
attctctttggaaccattgatacttggttggtttggaaattgactgatgggaaatgccat
gtgacggattattcaaacgcagctcgtaccatgctctacaacattgaagagttgaaatgg
gatgatgaaattttatctcttctcaatattccaaaagccatgctgccagaagttcgttca
aactctgaagtttacggcacaacagctccattccatttctatggcgcagaagtgccaatc
tctggcatggcaggtgaccaacaggctgccttatttggacaattagcatttgagccaggt
atggtgaaaaatacttacggaaccggttccttcatcgtgatgaatacaggtgaagagatg
cagttgtcacagaacaaccttctcacaacaattggctatggtatcggtggcaaagtctat
tatgcgcttgaaggatctatctttatcgctggttcggcggttcaatggctccgtgacagc
atgcgaatggtgactacatcacctgagtcagaagagcttgctcgtaagtctaccagcaat
gatgaagtctatgttgttccagcctttacaggacttggtgctccgtattggaactcagat
gcgcgtggctcagtctttggtctcactcgtggtacgactaaagaagacttcgtcaaagca
actcttcaatccattgcctaccaagttcgagatgttattgacaccatgcaattggataca
ggtattgatatttctgtcttgaaggttgacggtggtgcagcaatgaacagcctcctcatg
caattccaagcagatattttgggtattgaaatcgcacgcgctcaaaaccttgaaactaca
gctcttggagcagcattcttagcaggtttagcagttggtttctggaaagatttggatgaa
ttgaaagaactcaacgctgtcggccaatccttccaaccaaccatgaacgaagctcgtaaa
gaacaactttacaagggatggaaaaaagctgtcgcagcaactcaactatttgcagaagtg
gatgaagagcaataa

DBGET integrated database retrieval system