KEGG   Streptococcus suis A7: SSUA7_0771Help
Entry
SSUA7_0771        CDS       T02020                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssf  Streptococcus suis A7
Pathway
ssf00010  Glycolysis / Gluconeogenesis
ssf00052  Galactose metabolism
ssf00500  Starch and sucrose metabolism
ssf00520  Amino sugar and nucleotide sugar metabolism
ssf00521  Streptomycin biosynthesis
ssf01100  Metabolic pathways
ssf01110  Biosynthesis of secondary metabolites
ssf01120  Microbial metabolism in diverse environments
ssf01130  Biosynthesis of antibiotics
ssf01200  Carbon metabolism
Module
ssf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_0771
   00052 Galactose metabolism
    SSUA7_0771
   00500 Starch and sucrose metabolism
    SSUA7_0771
   00520 Amino sugar and nucleotide sugar metabolism
    SSUA7_0771
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSUA7_0771
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SSUA7_0771
Enzymes [BR:ssf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSUA7_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AER44098
Position
814929..815888
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDIIDSIKQRFETHGL
TKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGLPFFIDNDANVAAL
GEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHITVDFDEPFACTCG
KKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVFDLAKEGDDLALIV
YRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAENSFPQIKESTQIV
LATRGNDAGVLGAASLVLK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattatcggtattgaccttgggggaacttctgttaaattggccattttg
actactgagggagaaattcaagaaaaatggtctatcaagacaaatattttagatgatgga
agtcatattgttcctgatattattgacagtatcaagcagcgatttgaaacccatggtttg
acaaaggacgatttcttaggaattggtatgggctcacccggtgtagtggatagtgaagct
ggcactgttatcggagcctataacctcaactggaagaccttgcaattggtcaaagagcag
tttgaatctgcgctcggtttaccattctttattgacaatgatgcaaacgtagcggccctc
ggtgaacaatgggttggtgctggaaacaacaatccaaacgttgtctttatgacgcttggt
acaggtgtcggtggcggtgtcatcgctgctggaaacttgattcgtggtgtcaaaggtgct
ggtggcgaattgggccatatcacagttgactttgatgagccatttgcatgtacttgtggt
aagaaaggttgtctagaaacagttgcttcagcgacaggtattgtcaacctcagccgtcgc
tatgctgatcaatacgcaggcgatgcaaaactgaaacaaatgattgatgatgggcaagat
gtaacggctaaagatgtctttgatttggcaaaagagggcgatgatttggctttgattgtc
taccgtcacttctcagaatacttaggtgttgcttgtgcaaacattgctgcagtcctcaat
cctgcctacatcgttcttggtggtggtgtatcagctgcgggagagttcttattggatggc
gttcgcaaggtctttgctgaaaatagcttcccacaaatcaaggaaagtacacaaattgtc
ttggcaacacgtggtaatgatgcaggtgtattgggcgcagcatcactcgtcttgaaataa

DBGET integrated database retrieval system