KEGG   Streptococcus suis A7: SSUA7_0775Help
Entry
SSUA7_0775        CDS       T02020                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssf  Streptococcus suis A7
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUA7_0775
   00670 One carbon pool by folate
    SSUA7_0775
Enzymes [BR:ssf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSUA7_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817649..818161
Genome map
AA seq 170 aa AA seqDB search
MTKKIVAIWAQDENGLIGKGDRLPWSLPADLAHFKETTTGHTMVMGRITFDGMGKRALPN
RHTIVLTTDKTYQLESEHVTILHSVEDVLDWYNKQEQTLFVIGGGQIFTAFAPYIETLIV
TDIHGQFNGDVYFPKAFPMEKFQLQSANLRPKDEKNPYDFTIKTYERRDG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgttgccatttgggctcaagatgaaaatggattgattggaaaaggt
gatagacttccttggtcattgccagctgacttagctcatttcaaagaaacgacaacaggt
cacacgatggtgatgggacgtataaccttcgacggcatgggtaaacgtgctcttcccaat
cgtcacacaattgttttgacaacggataaaacctatcaactagagagtgaacatgttacc
attttacacagtgtggaagatgtcctagattggtataacaaacaggagcagacactattt
gtgattggtgggggacaaatttttactgcttttgcaccttacattgaaacattaatagtg
acagatattcacggtcaatttaatggcgatgtgtattttccgaaagcatttcctatggag
aaatttcagctacaaagcgccaatttacgtccaaaagacgagaaaaacccgtatgatttt
acaataaaaacctatgaaagaagagatggttag

  All links  
No link information was found.   
DBGET integrated database retrieval system