KEGG   Selenomonas sputigena: Selsp_0019Help
Entry
Selsp_0019        CDS       T01474                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ssg  Selenomonas sputigena
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Selsp_0019
DNA repair and recombination proteins [BR:ssg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Selsp_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15973..16578
Genome map
AA seq 201 aa AA seqDB search
MQYIAPLAKLIEHFRALPGIGSKTAVRLAYHVLDMDAAKARALAEAIVEAREKIGFCSVC
CNLSDQDPCAICASEKRDRSKICVVEQPQDVAAVERMKDYKGLYHVLHGSLSPLSGVGPE
NLRVKELLHRLEGEAGAEVQEIIMATNPTVEGEATAMYLARLLKPAGLKVTRIAHGLPIG
GDLEYADEVTLAKALENRKEI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatcgcaccgctggcaaaactcattgaacactttcgcgcactgccgggcatt
ggctccaagacggcagtgcgtcttgcttatcatgtcctcgacatggatgcagcgaaggcg
cgggcgctcgctgaggcgatcgtcgaagcgcgggagaagatcggcttttgcagcgtctgc
tgcaacctctcagaccaggatccttgtgcgatctgcgcatcggaaaagcgcgaccgctcg
aagatctgcgtcgtcgagcagccgcaggatgtcgccgccgtcgagcgcatgaaggactac
aaaggtctttaccatgtgctgcacggctcgctttcgccgctctcgggcgtaggccctgag
aaccttcgcgtgaaggagcttctgcatcggctggaaggagaggcgggcgctgaggtgcag
gagatcatcatggcgacgaatcccacggtcgagggcgaggctacggcgatgtacctcgcg
cggcttttgaagcccgcaggactcaaggtcacgcgcatcgcgcacggcctgcccatcggc
ggcgatctcgaatacgctgacgaagtcacgctcgccaaggcgctcgaaaacagaaaggaa
atctaa

DBGET integrated database retrieval system