KEGG   Selenomonas sputigena: Selsp_0197Help
Entry
Selsp_0197        CDS       T01474                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssg  Selenomonas sputigena
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Selsp_0197
   01230 Biosynthesis of amino acids
    Selsp_0197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selsp_0197
   00030 Pentose phosphate pathway
    Selsp_0197
   00051 Fructose and mannose metabolism
    Selsp_0197
   00052 Galactose metabolism
    Selsp_0197
  Energy metabolism
   00680 Methane metabolism
    Selsp_0197
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Selsp_0197
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Selsp_0197
Protein phosphatases and associated proteins [BR:ssg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Selsp_0197
Messenger RNA biogenesis [BR:ssg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Selsp_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
224494..225453
Genome map
AA seq 319 aa AA seqDB search
MISTIGVVTSGGDSPGMNAAARAVVRTAISEGVRIFGVYGGYTGLLDGDIKELSTRSVSD
LIQRGGTFLGTGRSKRFHTEEGRKAAMEKLKEHGIEGLVVIGGDGSLTGAAHLSRHGMPI
VGLPATIENDVWGTDYTIGADTAANTVLEAINKLRDTASAHRRIILIEVMGKKSGWLAMM
AGVAGGAEYVLVPEVKYDLDEICTEIMDAYEAGKKYSIIVVAQGAGSAVEMGKFIGETTK
IDTRVSVLGYIQRGGAPTVEDRMKASLLGERAALALMSGASDIVFGFDMGKVVSINLHDA
VTNRKTLDPEIVRLARVLA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtacgattggtgttgtgacttcgggcggtgacagcccgggcatgaatgcggcg
gcgcgcgccgtcgtgcgcacggcgatttccgagggcgtaaggattttcggcgtctacggc
ggctatacggggcttttggacggcgacatcaaggagctttcgacgcgtagcgtcagcgac
ctcattcagcgcggcggcactttcctcggcacggggcgttccaagcgcttccatacggag
gaggggcgcaaagcggcgatggaaaagctcaaagagcatggcatcgaaggcctcgtcgtc
atcggcggcgacggcagccttacgggcgcggcgcatctctcgcgccacggcatgccgatc
gtcggtctgccggcgacgattgaaaacgacgtctggggcacggactacacgatcggcgcc
gacacggcggcgaacacagttctggaggccatcaacaagctgcgcgacacggcgtcggcg
catcggcgcatcatcctcatcgaggtcatgggcaagaagtcgggctggctcgcgatgatg
gcgggcgtcgcgggcggcgctgaatacgtcctcgtgcccgaggtcaagtacgatctcgat
gagatctgcacggaaatcatggacgcttacgaggcgggcaaaaagtacagcatcatcgtc
gtggcgcagggtgcaggctctgccgtcgagatgggcaagttcatcggcgagacgacgaag
atcgatacgcgcgtatccgtcttgggctacatccagcgcggcggcgcgccgacggtcgag
gatcgcatgaaggcgtcgcttctcggcgaacgcgcggctctcgcgctgatgtcgggcgcg
agcgacatcgtcttcggatttgacatgggcaaggtcgtgagcatcaacctgcacgacgcc
gtgacgaaccgcaagacgctcgatcccgagatcgtgcgcctcgcacgcgttctcgcctga

DBGET integrated database retrieval system