KEGG   Selenomonas sputigena: Selsp_0279Help
Entry
Selsp_0279        CDS       T01474                                 

Definition
Carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ssg  Selenomonas sputigena
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
308168..308917
Genome map
AA seq 249 aa AA seqDB search
MIIEGAEPFLLPGGPHGVLLLHGFTGMPPEMRLLAEALYRAGHTVLCPRLAGHGTSPEDL
AHTDAEDWYDSALDGYAILSGLVPRISVVGHSMGALLALRLAAQKRVTGVVTLAAPIFID
EGRGMKHLPPRSACIGRFHPKLRKSLRDVPEFCNVTYDRMPLVAIHELVGFIEHVKALLP
KVYAPLLLVHSLHDRTAHRRSLRYIYDHVGAAHKEVLWLVRSGHLVMLDAERRAVFRRTA
SFLREMGSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgagggagcggagcctttccttttgccaggcggcccgcacggcgtgctgctc
ctgcatggcttcacgggcatgccgcccgagatgcggcttctcgctgaggcgctctatcgt
gcaggtcatacggtgctttgcccgcgcctcgccgggcacggcacgagtcccgaggatctg
gcacatacggatgctgaggactggtacgattcggctctcgacggctatgcgattctttca
gggctcgtgccgcgcatttctgtcgttggacattcgatgggggctttgctggcgcttcgt
ctcgcggcgcaaaagcgcgtcacgggcgtcgtgacgctcgccgcaccgatcttcattgac
gaggggcgcggcatgaagcacctgccgccgcgcagcgcgtgcatcggcaggtttcatccg
aaactgcgcaagtctctgcgcgacgtgcccgagttctgcaatgtgacgtatgacaggatg
ccgctcgtcgccatccacgaactcgtcggcttcatcgagcatgtcaaggcgctcttgcca
aaggtatatgcgccgctcctcctcgtgcactcgctgcacgaccgcacggcgcacaggaga
agcctccgctatatctatgaccatgtgggggcggcgcataaggaagttctttggctcgtg
cgctcgggtcatctcgtgatgctcgacgctgagcgacgggcagtctttcggcgtacggca
tcgtttttgcgcgagatggggagcgtttga

DBGET integrated database retrieval system