KEGG   Selenomonas sputigena: Selsp_0302Help
Entry
Selsp_0302        CDS       T01474                                 

Definition
glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssg  Selenomonas sputigena
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssg00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ssg00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(330805..332001)
Genome map
AA seq 398 aa AA seqDB search
MTKNRANRKTSLVPLLLCLIIFCTSLLLAGCLARSDDAASKDSAASHTQKGLSPDEKAAA
IVQKMSDAEKVGQLLMIGIQGAELDADSRFMLSEYHIGGVILFDRNMKSQEQVRALNDSL
QKNASDAGLPLFLAIDEEGGAVARMKEAFLPPPAAAEIGRTGDPQAAYRYAADTAHGLKA
MGFNLNFAPVADLGATYGRSYADDAATATKFVAAALEGHADAGLLATLKHFPGLGRGESD
THEDTVTVRADRATLEASDLVPFREMITKRNAAKNAKGASGWFVMATHTMYPALDAKNPA
SLSPAILQGLLREELSYDGVIVTDDLEMGAISRHYGFDRAGVEAILAGADLVLVCHDYAH
ETAVYNGLLKAVKSGEISKDRLDASVRRIVKAKIEYLE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaatcgcgcgaaccgcaaaacctccctcgttcctctactcctctgtctgatc
atcttctgcaccagcctgctcctcgcgggctgccttgcgcgctctgacgatgccgcctcg
aaagattccgctgcgagccatacgcaaaaaggcctctcgcccgatgaaaaagcggccgcc
attgtacagaagatgagcgacgccgagaaggtcgggcagctcctcatgatcggcatacag
ggagcggagctcgatgcggacagccgcttcatgctttcggagtatcatatcggcggcgtc
atcctctttgaccgcaatatgaagagtcaagagcaggtgcgtgcgctgaacgattccctg
cagaaaaatgcctcggatgcaggactgccgcttttcttggccatcgacgaggaaggcggc
gccgtcgctcgcatgaaggaggcattcctgccgccgcccgccgccgcagaaatcggccgc
acgggcgacccccaggcggcataccgttatgccgccgacacggcgcacggactcaaggcg
atgggattcaacctgaacttcgcccccgtcgccgacctcggtgcgacctatgggcgctcc
tatgccgacgatgccgccaccgcgacaaagtttgtcgccgccgccctcgaaggccacgcg
gacgccgggcttctcgcgacgctcaagcacttccccggtctcggacgcggcgagagcgac
acgcatgaagacacggtcaccgtgcgcgccgaccgcgctaccctcgaagcgagcgacctc
gtgccgtttcgcgagatgattactaaaaggaacgctgcaaagaatgcgaaaggcgctagc
ggctggttcgtcatggcaacgcacacgatgtacccggcgctcgatgccaagaatcctgcc
agcctttcgcccgccatcctgcagggcctcctccgagaagagctctcctacgacggcgtc
atcgtgaccgacgaccttgaaatgggcgcaatctcacgccactacggcttcgatcgcgcg
ggcgtcgaagcgatcctggcgggagcagacctcgtgctcgtctgccacgactacgcgcac
gaaaccgccgtctacaacggcctcctgaaagccgtgaaaagcggcgagatctccaaagac
cgcctcgacgcttccgtccggcgcatcgtcaaggcaaagatcgaatatctcgaatag

DBGET integrated database retrieval system