KEGG   Selenomonas sputigena: Selsp_0355Help
Entry
Selsp_0355        CDS       T01474                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssg  Selenomonas sputigena
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Selsp_0355
Enzymes [BR:ssg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Selsp_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402160..404343
Genome map
AA seq 727 aa AA seqDB search
METLEGTAQSVVFAAPEGGFTVFRLRPSGRRGLVTVTANAPAPLVGQEIALSGEWVQHPR
FGEQFKAATLRVSAPTSLAGIERFLASGAIAGVGEAMAHRLVQKFGKETLEIIEKKPSRL
TEVAGVGKKTAAKIHASYMEKEELREIMLWLEMHGVSGAYAARIFETYSSFAIEVMEKHP
YRLARDIAGIGFLTADAIAKSAGIAEDSKERIEAGLGHALLTVSQQGHCCIPAPALTERA
AKLLGTPTEEVREVLKEALAAERLAFEEVGAETLIYPPWLYRAEKRTAQMLFFLQQKAAV
LPAERAAAIVADWERAAGITLAAEQQQAVAAVLDHAVFVLTGGPGTGKTTVVRGMIAVLE
SQGLSVLLGAPTGRAAKRLAEATGRKAETVHRLLGAQGGIEADGSPVFEKDADDPLDADA
IILDEVSMMDIVLMEHFLEAVPEGARVILVGDVDQLPAVGPGAVLKDILRSGAVPSVRLK
EVFRQSGEGTIVLNAHAINRGRMPQFAVGGDFEFLEMPDEETAARRIVALCREELPREGF
SALDAVQVLSPMHRTPCGVDNLNRLLQAALNPPAPEKAEFRNSTLTLRVGDKVMQTKNDY
TKGVFNGDIGFIREVSADGVKVRYSDELTADYEPNELMMLTLAYAMSVHKSQGSEYPVIV
LPLVAAHHIMLQRNLLYTAVTRAKKKVVLLGSKAAVFTAVSNDRTRRRYTLLAERLAGAG
GESPLLS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgctcgaagggacggcacaaagcgtcgtctttgccgcgcccgaggggggcttc
acggtctttcgcctgcggccatcggggcggcgcggactcgtgacggtgacggcgaacgcg
cccgcaccgctcgtggggcaggagattgcgctttcgggcgagtgggtgcagcacccgcgc
ttcggtgagcagttcaaggcggcgacgcttcgcgtttctgcgccgacgagtctcgcgggc
atcgagcgcttccttgcgtcgggcgcgatcgcgggcgtcggcgaggcgatggcgcaccgc
ctcgtgcagaagttcggcaaggagacgcttgagatcatcgagaagaagccctcgcgcctc
accgaggtcgcgggcgtcggcaagaagacggcagcgaagatccacgcttcctacatggag
aaggaagagctaagagagatcatgctgtggctcgaaatgcatggcgtttcgggcgcgtac
gccgcacgcatcttcgagacgtacagctcctttgccatcgaggtcatggagaagcatccg
taccgtctggcacgcgacatcgccggcatcggctttttgacggcggatgcgattgccaag
agcgcagggatcgccgaggacagcaaggaacgcatcgaggcagggctaggccatgcgctc
ctcaccgtctcccagcaggggcattgctgcatccctgcgcccgctttgacggagcgtgcg
gcgaagctcctcggcacgccgacggaggaggtgcgcgaggtcttgaaggaagccttggcc
gccgaacggctcgccttcgaggaggtcggcgcggagacgctcatctatccgccgtggctc
taccgcgcggagaagcgcacggcacagatgcttttcttcctgcagcagaaggccgccgtg
ctgcccgcagaaagggcggcggccatcgtcgccgactgggagcgggcggcgggcatcacg
ctcgccgcagagcagcagcaggctgtcgccgccgtgctcgaccatgcggtctttgtgctg
acgggcggcccgggcacgggcaagacgacggtcgtgcgcggcatgatcgcagttcttgag
agccaggggctctccgtgctcctcggtgcgccgacgggacgcgcggcgaagcggctcgca
gaggcgacggggcgcaaggcggagacggtgcatcggcttctgggcgcacagggcggcata
gaggccgacggctcgcccgtattcgagaaggacgcggacgatcctctggacgccgacgcc
atcatcctcgacgaggtgtcgatgatggacatcgtgctcatggagcatttccttgaagcc
gtgcccgagggcgcgcgcgtcatcctcgtcggcgatgtcgaccagcttcctgccgtcggc
cccggcgccgtcctcaaggacatcctgcgctcgggcgctgtgccgagcgtgcgcttgaag
gaagtctttcgccagagcggcgagggaacgatcgtcctgaacgcgcacgcgatcaatcgc
gggcgcatgccgcagttcgctgttggcggcgatttcgagttcctggagatgcccgacgag
gagacggcggcgcggcgcatcgtcgcgctgtgccgcgaggagctgccgcgcgagggattt
tccgctctggacgcggtgcaggtactgtcgcccatgcaccgcacgccgtgcggcgtcgac
aatctgaaccgcctcctgcaggcggcgctcaacccgcccgcgcccgaaaaggcggagttt
cgtaacagcacgctcacgctgcgcgtcggcgacaaggtcatgcagacgaagaacgactac
acgaagggcgtgttcaacggcgatatcggcttcatccgcgaggtgtcggcggacggcgtc
aaggtgcgctattccgacgaactgacagcggactacgagccgaatgaactcatgatgctc
acgctcgcctacgccatgagcgtgcacaagagccagggcagcgagtaccccgtgatcgtc
ctgccgctcgtcgctgcgcatcacatcatgctgcagcgcaatctcctctatacggcggtg
acgcgtgcgaagaagaaggtcgtgctgctcggctcgaaggcggctgtcttcacggcggta
tcgaacgataggacgcgcaggcgctacaccttgctcgccgagaggcttgcgggcgcgggc
ggcgagagtccgctgctctcgtga

DBGET integrated database retrieval system