KEGG   Selenomonas sputigena: Selsp_0361Help
Entry
Selsp_0361        CDS       T01474                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ssg  Selenomonas sputigena
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Selsp_0361
Enzymes [BR:ssg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Selsp_0361
Exosome [BR:ssg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Selsp_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(409419..410393)
Genome map
AA seq 324 aa AA seqDB search
MLKQTLRPRRLRRTANIRAMVRETELSVRDFVYPIFVVPGENIKEEIPSMPGCFHLSVDR
AVEQAKELAALGIPSVEVFGLPEYKDEIGSSAWDAKSPVQQAIRAIKQAEPELAVVGDVC
LCQYTSHGHCGKLCGHEVDNDATLPLLAKTAVSQAEAGADIVAPSDMMDGRIAALREALD
EAGFSHVSIMSYTVKYASAYYGPFRDAADSAPSFGDRRAYQMDPANAREAMKEVALDLAE
GADIIMVKPALAYLDIVRRVRDAIDRPVAVYNVSGEYAMVKAAAANGWIDEKRIVLETLT
GMKRAGADIIITYHAIDAAKWLQS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcaaacccttcgtccgcgccgcctgcgcaggacggcgaacatccgcgccatg
gtgcgcgagacggagctttccgtccgtgatttcgtctaccccatcttcgtcgtgcccggc
gagaatatcaaggaggaaatccccagcatgccgggctgcttccacctctccgtcgaccgc
gccgtcgagcaggcgaaagaactcgccgccctcggcattccctccgtcgaagtcttcggc
ctgcccgagtacaaggacgagatcggctcttcggcatgggacgcgaaaagtcccgtgcag
caagcgatccgcgccatcaaacaggcggagccggagcttgccgtcgtcggcgatgtctgc
ctttgccagtacacgtcgcacggccactgcggcaagctatgcggccacgaagtcgacaac
gacgcgacgctgccgctccttgccaagacagcggtcagccaggcggaagccggcgccgac
atcgtcgcgccgtccgacatgatggacggacgcatcgccgccctgagagaagccttggac
gaagccggcttctcccatgtctccatcatgagctacaccgtcaagtacgcttcggcgtac
tacggccccttccgcgacgctgcggactccgcgccctccttcggcgaccgccgcgcctac
cagatggatcccgccaacgcacgcgaggcgatgaaggaagtcgcgctcgacctcgccgag
ggcgcggacatcatcatggtcaagcccgcgctcgcctacctcgacattgtgcgccgcgtg
cgcgacgccattgaccgccccgttgccgtctacaacgtcagcggcgaatacgcgatggtc
aaggcggcggcagcgaacggctggatcgacgaaaagcgcatcgtgctcgaaacgctcaca
ggcatgaagcgtgcgggcgccgacatcatcatcacctaccacgcgatcgacgcggcgaag
tggcttcaaagctga

DBGET integrated database retrieval system