KEGG   Selenomonas sputigena: Selsp_0818Help
Entry
Selsp_0818        CDS       T01474                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssg  Selenomonas sputigena
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selsp_0818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Selsp_0818
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Selsp_0818
Enzymes [BR:ssg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Selsp_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
915233..916720
Genome map
AA seq 495 aa AA seqDB search
MKYSSTRGKAASVASAEAIIQGLAADGGLFVPEEMPKADPDFIAGMRQLSYEERAARILG
LFLTDYTSEELAGCIARAYGGDKFDDVRIAPVHALKEFPVLELWHGPTSAFKDMALQLLP
QLLQTALKKTGEDAEILILVATSGDTGKAALEGFADVDQIKILVFYPTGGVSKIQNLQMC
TQKGANVRVVAVEGNFDDAQNGVKEIFGDKAFGEKLAAGNVKLSSANSINWGRLVPQIVY
YFSAYADLLEKGTMAAGEAVDFCVPTGNFGDILAGYYAKRMGLPVAKLICASNSNNVLTD
FLQTGVYDKKRDFYKTISPSMDILISSNLERLLYHETQDAALVRGWMEELAAKGRYEVGE
TVLQNLKETFWAGWVDDAATKETIREVYEKEHYVLDTHSAVAYRVAQAYKKETGSERPLV
VVSTASPYKFNESVLDALGEERAGLDEFAQLDKLASLNESPIPQGLASLKTAEILHRAVC
EKTEMHAVTEGFAKK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacagcagtacgagaggaaaggcggcaagcgtcgcatcggcagaggcaatcatc
caggggttggcggcggacggagggcttttcgtgcccgaggagatgcccaaggctgatccg
gattttattgcagggatgcggcagctttcctatgaggagcgcgcggcacgcattctggga
ctcttccttacggattacacgtcagaggagcttgcaggctgtattgcacgcgcttacggg
ggcgacaagtttgacgacgtgcgcatcgcgcccgtgcacgcgctcaaggagttccccgta
ttggagctctggcacgggccgacgagtgcgttcaaggacatggcactgcagctcttgccg
cagcttttgcagacggcgctcaagaagacgggtgaggacgctgagattctgattctcgtt
gccacgtcgggtgacacgggcaaggcggcgctcgaaggttttgccgatgtcgatcagatc
aagatcctcgtgttctatccgacgggcggcgtgtcaaagatccagaacctgcagatgtgc
acgcagaagggcgcaaatgtccgtgtcgtcgcggtcgaggggaattttgacgatgcgcag
aacggcgtcaaggagattttcggcgacaaggcctttggagagaagctcgccgccgggaac
gtcaagctgtcttcggcaaattcgatcaactggggcaggctcgtgccgcagatcgtctac
tacttcagtgcctatgccgacctcttggaaaaggggacgatggcagcgggcgaagccgtc
gatttctgcgtgccgacgggcaatttcggcgatattctcgcgggctattacgccaagcgc
atggggcttcccgtcgcgaaactgatctgtgcgtcgaacagcaacaacgtgctgacggat
ttcctgcagacgggcgtttatgacaagaagcgcgatttttacaaaacgatctcgccgtcc
atggacatcttgatttcgagcaatcttgagcgtctgctctaccatgagacgcaggatgcg
gcactggtcaggggctggatggaggagcttgccgcaaagggcaggtacgaggtcggcgag
actgtgctgcagaatcttaaagagacgttttgggctggctgggtcgacgacgcggcgacg
aaggaaacgattcgcgaagtctacgaaaaggagcattatgtgctcgacacgcattcggct
gtcgcgtatcgcgtggcacaggcgtataagaaggagacgggaagcgagcgcccgctcgtc
gtcgtctcgacggcaagcccgtacaagttcaacgaaagcgtcttggacgcgctcggagaa
gagcgtgcgggactcgacgaattcgcgcagctcgacaagctcgcttccttgaacgaaagc
ccgattccacagggattggcatcgctgaaaacggctgagatcctgcatcgcgcagtgtgc
gagaagacggaaatgcatgctgtaacggaaggatttgcgaagaaataa

DBGET integrated database retrieval system