KEGG   Selenomonas sputigena: Selsp_0948Help
Entry
Selsp_0948        CDS       T01474                                 

Definition
Aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssg  Selenomonas sputigena
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Selsp_0948
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Selsp_0948
Enzymes [BR:ssg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Selsp_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065071..1066030
Genome map
AA seq 319 aa AA seqDB search
MSKNPVSLRGKNILGLEDFSPEEIQLVLDSAKGMKNVIHRDIKKLPTLRGKSIVTLFYEP
STRTRSSFELAGKYLGADVVNITAGTSSIVKGESLRDTLLTVEAMGVDAIVMRHKAEGAA
AYATQVVSPVIINAGDGAHAHPSQGLLDLFIILQYKNTLQGLKVAIIGDISHSRVARSDL
WGMRKMGMEVHLAGPKTLLPRFLKEEPGIFVHECIEDAIRDADVINVLRIQLERQKAGLF
PSMREYARIFGLNEERLKLAKEDVLVLHPGPMNKGLEISPRVAYSSHSAIQEQVQNGVAV
RMALLALALMGGKQNEADL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaagaatcctgtttcattacgcggcaaaaacattttaggactggaagatttctca
ccggaggaaatccagcttgtccttgattctgccaaaggcatgaagaatgtgatccacagg
gatatcaagaaacttcccacattgcgaggaaagtcaatcgtcacattgttctatgagccg
agcacgaggacgcgctcctctttcgagttggcgggcaagtatctcggcgctgatgtcgtc
aatatcacagcggggacgagcagcatcgtcaagggggagagtctgcgcgatacgctgctg
acggttgaagccatgggagttgatgccatcgtcatgcgccacaaggctgaaggtgcggcg
gcctatgcgacacaggttgtgtcgcccgtgatcatcaatgcgggcgatggagcgcatgca
catccgtcacagggcttgttggatttgttcatcatcttgcagtacaagaataccttgcaa
ggcctgaaggtcgccatcatcggcgacatttcgcacagccgcgtggcgcgctccgatcta
tggggcatgcgcaaaatggggatggaggttcatctggccggaccgaagacactgctgccg
cgctttcttaaagaagaaccgggaatcttcgtgcatgagtgtatagaagatgccatccgc
gatgcggatgtcatcaatgtgctgcgcattcagcttgaaaggcagaaagcaggtcttttc
ccttccatgcgtgagtacgcacgcatcttcggtttgaatgaggaaaggctgaagcttgct
aaggaggatgtgcttgtactgcatccgggtccgatgaacaagggactggaaatatcaccg
cgtgtagcttacagcagccattccgccatacaggagcaggtgcagaacggcgtggcagtt
cgcatggcgctcttggctctggcattgatgggaggaaagcagaatgaagcagatctttaa

DBGET integrated database retrieval system