KEGG   Selenomonas sputigena: Selsp_1087Help
Entry
Selsp_1087        CDS       T01474                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssg  Selenomonas sputigena
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Selsp_1087
Enzymes [BR:ssg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Selsp_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217323..1217928
Genome map
AA seq 201 aa AA seqDB search
MIGFLRGKVARLSLDFCFLDVAGVGYRVFISGATHGRLHMGEEVTLFTHLAVREDAMTLY
GFFSEEEYELFQMLISVTGIGPKAALGILSNITPENLCLAVRNKKADILTKAPGIGKKSA
ERIILELKDKMKGFMTEHEAIVEEGLLEEPVEDTMLAEAGAALLSLGYTQAEFTPILRRA
KDCKDAEALIRFALKEFAQHR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtttcctgcggggaaaggtcgcgcgcctttcccttgatttttgctttcttgat
gttgcaggcgtcggctaccgcgtcttcatttcgggcgcgacgcatggtcgcctgcacatg
ggcgaagaagtgacgctcttcacgcatctcgccgtgcgtgaggacgccatgacgctctac
ggcttcttttccgaggaggagtacgagctttttcaaatgctcatctccgttacgggaatc
ggtcccaaggcggcgcttggcatcttatcgaacatcacgcccgagaacctttgccttgcc
gtaaggaacaagaaggcggacattttgacgaaggcgccgggcatcggcaagaagtcggcg
gaacgcatcatcttagaactcaaggacaagatgaagggatttatgacggagcacgaagcg
attgtcgaggaaggcttgctcgaagagcctgtcgaagatacgatgcttgccgaggcgggc
gccgcgctcctctcgctcggctacacgcaggcggagttcacgccgatcctgcggcgtgcc
aaagactgcaaggacgctgaggcgctgattcgttttgcgctgaaggagtttgcccaacat
cgctga

DBGET integrated database retrieval system