KEGG   Selenomonas sputigena: Selsp_1131Help
Entry
Selsp_1131        CDS       T01474                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ssg  Selenomonas sputigena
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selsp_1131
  Amino acid metabolism
   00340 Histidine metabolism
    Selsp_1131
Enzymes [BR:ssg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Selsp_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268645..1269994
Genome map
AA seq 449 aa AA seqDB search
MKIVSAKELGKDKIRKLLVKPPFDEVQLNPKIREANRKIFGADLTAAEVAVRIVEDVRRH
GDEAVIKYTKLIDGTDFSPEDFQVSEEEFAEAEKNADPAIVASLQRAAHNVRSYHEEQKA
NSWLTYREKGSILGQSLIPLDRAGIYVPGGTAAYPSSVLMNAVPAAVAGVGEIIMMVPPK
NGKINPYVLLAAKIAGVSKVYKIGGAQAIAAMAYGTATIPRVDKITGPGNIFVTLAKKAV
YGHCDIDMLAGPSEILIVADETADPAYTAADMLSQAEHDTLASSILITTSAKLAHEVEAL
LEEQLKGLPRENIARASIENNGLIVIADDIMEALEYANISAPEHMELLTKQPFELLPYVR
HAGAVFLGAYSPEPLGDYFAGPNHVLPTGGTARFYSVLNVETFMKRTSIISYTKDALHDV
EADIIRLAEAEGLHAHANAVRLRSKERKD
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgtatcggcaaaagagctcggtaaagataaaatacggaagctcttggtgaag
ccgcccttcgatgaggtgcagctcaatccaaagattcgcgaggcgaaccgaaagatcttc
ggcgccgatctcacggcggcggaagtcgccgtgcgcatcgtcgaggacgtgcgccgtcat
ggcgatgaagccgtcatcaagtacacgaagctcatcgacggcacggatttttcccccgaa
gattttcaagtgtcggaagaggaatttgccgaagcggaaaaaaatgcagacccggcaatc
gtcgcatcgctacaaagagccgcgcacaatgtgcgcagctaccacgaagaacaaaaagca
aattcatggctgacgtaccgtgaaaaaggctcaattctcgggcagtcgctgattccgctc
gaccgcgcgggcatctatgtgccgggcggcacggcggcgtatccgtcctccgtcttgatg
aacgctgttccggctgccgtcgcaggcgtcggcgagatcatcatgatggtgccgccgaaa
aacggcaagatcaatccctatgtgcttcttgcggcgaagattgcgggcgtgtccaaggtc
tacaagatcggcggcgcacaagcaatcgccgccatggcgtacggcactgcgacgattccg
cgcgtcgacaagatcacgggtcccggcaacatcttcgtcacgctcgcgaagaaagctgtt
tacggccattgtgacatcgacatgctcgccggcccgagcgagatcctcatcgtcgccgac
gagacggcagatcccgcctatacggcagccgatatgctgagtcaggcggagcatgacact
ctggcgtcaagcatcctcatcacgacgagcgcaaagctcgcgcatgaggtcgaggctctg
ctggaggaacagctgaaagggctgccgagggaaaatatcgccagagcgtccatcgagaac
aacggtctcatcgtcatcgccgatgacatcatggaagcattggaatacgcgaacatttcc
gcgcctgagcacatggaacttctgacgaagcagccgttcgagcttctgccctatgtgcgc
catgcgggagccgttttcctcggcgcatattctccggaacccttgggcgattacttcgcg
ggtcccaaccatgtattgccgacgggcggcacggcgagattctattccgtgctcaacgtc
gagaccttcatgaagcgcacgagcatcatttcctatacgaaggacgccctgcatgatgtg
gaggcggacatcatacgtctggcggaggcggaggggctgcacgcccatgccaatgccgta
cgtctgcgcagcaaggagaggaaggactga

DBGET integrated database retrieval system