KEGG   Selenomonas sputigena: Selsp_1186Help
Entry
Selsp_1186        CDS       T01474                                 

Definition
pseudouridine synthase, RluA family
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ssg  Selenomonas sputigena
Brite
Enzymes [BR:ssg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Selsp_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332253..1333158
Genome map
AA seq 301 aa AA seqDB search
MGKTRLVVPEGLTCMALREFLQKECGFSTTLWKKLRRSGTFSLNGLPANAARIRIKSGDE
LCWHLAEESRIAPEDIPLEILYEDAALLIVNKPAGMLVHPTGGEYRHTLANAVLFHYEAH
GEKHAFHPVHRLDRQTSGLVLIAKEAHVQHLLSAHNAIERIYLAVIEGKLPEPCGTIDAP
IARRPGSIIERMVSPAGKCAVTHYATLAERGGLSLLALRLATGRTHQIRVHLAHLAHPLL
GDDLYGGRTDRIARQALHAHRLRFRHPISGKEITVHAPFPADMSAFFPEICSNFSLFTKD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagacgcggcttgtcgtgccggaaggactgacttgtatggcgcttcgggagttt
ctgcaaaaggagtgcggcttctccacgacgctctggaaaaaactgcggcgttcgggcacg
ttctcgctgaacggactccccgccaacgccgcacgaatccgcatcaaaagcggcgatgag
ctttgctggcatctggcggaagagagccgcatcgcgcccgaagacattccgctcgagatt
ctctatgaggacgcggcgcttctcatcgtcaacaagcctgcaggcatgctcgttcatccg
acgggcggcgagtaccgtcatacgctcgccaacgccgtgctctttcactacgaagcgcac
ggcgaaaagcacgcctttcatcccgtgcaccgcctcgaccgtcagacaagcggactcgtg
ctcatcgccaaggaggcgcacgtgcagcacctcttgtccgcacataatgcaatcgagcgc
atctacctcgccgtcatcgaaggcaaactgcccgagccttgcggcacgatcgacgcgccc
atcgcgcgccgccccggcagcatcatcgagcgcatggtttcgcctgccggaaaatgtgcc
gtcacgcactatgcgacgcttgcagagcgcggcgggctttcgcttctcgcgcttcgcctg
gcgacgggacgcacgcatcagatccgcgtccacctcgcgcacctcgctcatccgctcctc
ggcgatgacctctacggcggcagaacggatcgcatcgcccgtcaagcgctgcacgcccat
cgcctgcgctttcgtcacccgataagcggcaaagaaatcaccgtgcacgcaccctttcct
gcagatatgtccgcctttttccccgaaatctgcagtaatttttctcttttcacaaaagat
tcatga

DBGET integrated database retrieval system