KEGG   Selenomonas sputigena: Selsp_1260Help
Entry
Selsp_1260        CDS       T01474                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ssg  Selenomonas sputigena
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Selsp_1260
Enzymes [BR:ssg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Selsp_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1423593..1424474)
Genome map
AA seq 293 aa AA seqDB search
MLKDNVETFLGCDTSYEESRIVLFGAPFDSTTSFRPGTRFASRTMRAESYGLETYSPYLD
LDMEETRVFDGGDLELCFGDTARALGQIEDFARNLLADGKKPFMIGGEHLVTLPVVRALA
ERYEDLHIVHFDAHTDLRDDYLGAKLSHATVMRRAWDILGDGRIHQFGIRSGERAEFLWA
KEHTHLQRFDFTGLEWSLSELMGKPVYLTLDLDVLDPSGFPGTGTPEPGGVSFLDLLRAL
RKTLRLDRIVGCDMVELSPHYDASGASTAVALKLLREMLLAWEEPAIRGAEMV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagataatgtagaaacttttctgggctgcgacacatcgtatgaagagtcgcgc
atcgtgctcttcggcgcacctttcgattcgacgacgtcgtttcgcccgggcacgcgcttt
gcgagccgcacgatgcgtgccgagtcgtacgggctggagacgtacagcccatatctcgac
cttgatatggaggagacgcgcgtctttgacggcggcgacttggagctttgctttggcgat
acggctcgcgccctggggcagatcgaggactttgcgcggaacctgctcgccgatggcaag
aagcccttcatgatcggcggcgagcatctcgtgacgcttcccgtcgtgcgtgcgctcgct
gagcgctacgaagatctccatatcgtgcatttcgatgcgcatacggatctgcgcgatgat
tacttgggcgcgaagctctcgcacgcgacggtcatgcgtcgcgcctgggatatcttgggg
gacggacgcattcatcagttcggcatacggagcggcgagcgcgcggagttcctctgggcg
aaggagcacacgcatttgcagcgcttcgatttcacggggcttgaatggagtctctctgaa
ctcatgggaaagcccgtgtacttgacgctcgatctcgatgtgctcgatccgagtggtttt
cccggcacgggcacgcccgagccgggcggcgtgagcttcctcgatcttcttcgtgcgctc
cgaaagacgctgcggctcgaccgcatcgtcggttgcgacatggtcgaactgtcgccgcac
tacgatgcgagcggcgcatcgacggcggtggccttgaagctcctccgagagatgcttctc
gcttgggaagagccggcaattcgcggagcagagatggtttga

DBGET integrated database retrieval system