KEGG   Selenomonas sputigena: Selsp_1513Help
Entry
Selsp_1513        CDS       T01474                                 

Definition
tryptophan synthase, beta subunit (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssg  Selenomonas sputigena
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selsp_1513
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Selsp_1513
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Selsp_1513
Enzymes [BR:ssg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Selsp_1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1664240..1665463)
Genome map
AA seq 407 aa AA seqDB search
MDFKRYLKEYPNKEGRFGKFGGAYLPEELVPAFAEINEAYLTICHSSQFINELRRIRREF
QGRPTPVYHCERLSRKIGNCQIYLKREDLNHSGAHKLNHCMGEGLLAKFMGKKRIIAETG
AGQHGVALATAAAFFGLDCTIYMGEVDIKKQAPNVARMKVLGAKVVPVSRGAKTLKEAVD
AAFEDYLANYKETIYCIGSAVGPHPFPMMVRDFQTVVGIEAREQFKDMMGFLPDVVTACV
GGGSNAIGMFVPFLDDPVEIVGIEPLGLGKKLGDHAASMSYGEEGVMHGFDSIMLKDAAG
EPAPVYSVASGLDYPSVGPEHAFLREIGRVKYDTATDEEAIGAFFKLSRYEGIIPALESS
HAVAYAMRRAKEMDTGSILVNLSGRGDKDLDYVIEKYGTGEKYLEFA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaagcgttatctcaaggaatatccgaacaaggaggggcgtttcggcaaattc
ggcggcgcttacctgccggaagaactcgtgcctgcttttgcagaaatcaacgaggcgtat
ctgacgatttgccattcctcgcagttcatcaatgagctgcggcgcatacgccgcgagttt
caaggacggccgacgcctgtctaccactgcgagcgcctttcgcgcaagatcggcaactgc
cagatttatttgaagcgtgaggatttgaatcactcgggtgcgcacaagctcaatcattgc
atgggagaggggcttctggcgaagttcatgggcaagaagcgcatcattgctgagacgggc
gcgggacagcacggcgtggcgctcgcgacggcggcggccttcttcgggctcgactgcacg
atctacatgggtgaggtcgacatcaagaagcaggcgccgaatgtggcgcgcatgaaggtg
ctcggcgcgaaggtcgtgcccgtttcgcgcggtgcgaagacgctcaaggaagctgtcgat
gcggcttttgaggattatctggcgaactacaaggagacgatctactgcatcggctctgct
gtcggaccgcatccgttccccatgatggtgcgcgatttccagacggtcgtaggcatcgag
gcgcgcgaacaattcaaggatatgatggggttcctgcccgatgttgtgacggcgtgcgta
ggcggcggcagcaatgccatcggcatgttcgtgccgttcctcgacgatcctgtggagatc
gtcggcatcgagcctctggggcttggcaagaagctcggcgatcatgcggcatccatgtcg
tatggcgaagagggcgtcatgcacggctttgacagcatcatgctcaaggacgcggcgggc
gagccggctcctgtgtattcggtagcaagcggactcgactacccatccgtcggccccgag
cacgcctttttgcgcgagattgggcgcgtcaagtacgatacggcgacggacgaggaggcg
atcggcgccttcttcaaactttcgcgctacgagggaatcatccccgcgctcgaaagctct
catgcggtcgcctacgccatgcgccgcgccaaggagatggatacgggctcgatcctcgtc
aatctcagcggcaggggcgacaaggatctcgactacgtcattgagaagtacggtacgggc
gagaagtatctggaatttgcttga

DBGET integrated database retrieval system