KEGG   Selenomonas sputigena: Selsp_1776Help
Entry
Selsp_1776        CDS       T01474                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00260  Glycine, serine and threonine metabolism
ssg00750  Vitamin B6 metabolism
ssg01100  Metabolic pathways
ssg01110  Biosynthesis of secondary metabolites
ssg01120  Microbial metabolism in diverse environments
ssg01230  Biosynthesis of amino acids
Module
ssg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Selsp_1776
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Selsp_1776
Enzymes [BR:ssg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Selsp_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP CSM2 DUF674
Motif
Other DBs
NCBI-ProteinID: AEC00732
UniProt: F4EWX8
Position
1946490..1947485
Genome map
AA seq 331 aa AA seqDB search
MYFYCEKCKKKYPISSMNYRCECGGMFHLNKAANEETVHEVTIGHMHTELLSIKIDGIEY
LLKTENLLPTGSFKDRGAYTLINEIHHVGIEKIALDSAGNAGASIAAHAAAAGIDCTVYV
PKETSPDKLRQIAAYGAKIVKAEGGRMGACQAVKENLGDAYYASHVYNPLFFEGMKAMAY
EIYEQLGESVPEYIFLPVGNGTMLLGLYYGFIEIGRLPRLVPVQSKNCAPLYEAFNKIPA
SPKTETIADSIRIETPKRLNDMLAAVTNSGGDVLIVEDEDIVRCKEMLGRRGIYVETTSA
AALAGAMQIFGKAKPDNYRVVVPLTGSGLKG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgtatttttactgcgaaaagtgcaaaaaaaaatatcccatcagctcgatgaactatcgc
tgcgaatgcggcggcatgttccatctgaacaaggcggccaacgaagagactgtgcatgaa
gtcacgatcggacacatgcacaccgaacttttgagcatcaagattgacggcatcgagtat
ctgctgaagacggagaaccttctgccgaccggatccttcaaggatcgcggcgcttacacg
ctgatcaatgagatccaccacgtcggcatcgagaagatcgcgctcgattcggcaggcaac
gccggcgcctccattgccgcgcacgcagcggcggcgggcatcgactgcacagtctacgtg
ccgaaggagacgtcgcctgacaaactgcgtcagattgccgcctacggcgcgaagatcgtc
aaagctgaaggcgggcgcatgggcgcgtgccaagcggtcaaggaaaacctcggcgacgcc
tactatgcttcgcatgtctacaatccgctcttcttcgagggcatgaaggcgatggcatac
gagatttacgagcagctcggcgagagtgtgcccgagtacatcttcctgcctgtcggtaac
ggcacgatgctcttagggctttactacggcttcatcgagatcggccgcctgccgcgcctc
gtgcccgtgcagagcaagaactgcgcgccgctctacgaggcgttcaacaagataccggca
agtccgaagacggagacgatcgccgattcgatccgcatcgaaacgcccaagcgtctgaac
gacatgcttgccgccgtcacgaacagcggcggcgacgtcctcatcgtcgaggacgaggac
atcgtacggtgcaaggagatgctcggacgccgcggcatctacgtggaaacgacaagcgcc
gcagctctcgccggagccatgcagatcttcggcaaggcaaagcccgacaactatcgtgtc
gtcgtgccgctgacaggctcgggactcaaaggataa

DBGET integrated database retrieval system