KEGG   Selenomonas sputigena: Selsp_1823Help
Entry
Selsp_1823        CDS       T01474                                 

Definition
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase ;UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13 6.3.2.10)
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
ssg  Selenomonas sputigena
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Selsp_1823
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Selsp_1823
Enzymes [BR:ssg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Selsp_1823
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Selsp_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2005377..2008277)
Genome map
AA seq 966 aa AA seqDB search
MKTLAELAALVEGAEIKGDAAAKIADIVHDSREVTEGTLFVAIEGLHVDGHSFIAQAVEK
GACAILTEREIEIPEGAAAVLRVPNLAAALEVIVPFFHDYPSRKMRIIGITGTNGKTTTS
YMTRAILREAGYKVGLIGTIQILVEDEALPIHNTTPDVVVLERTLAYMARRGMDFVVMEV
SSHALDQNRVAGIEFDTAVFTNLTQDHLDYHKTLENYKRAKARLFDLVSRKGAKEGKTAV
VNDDDAAGETMLAHAKCAHLTYAVKKEAALRAENIRVHARGLELTLAGAFGRMDLSLGVT
GIFNVYNVMSAVGAALAERIAPEAIKRALEAFKSVPGRFELVDAGQAFSIIVDYAHTPDG
LENILNTAREIAAGRILTVFGCGGDRDRTKRPIMGRIAAALSDVVLVTSDNPRTEDPARI
LDEVEVGVLEKIGDKCHEKIADRRTAIVRAVALAEKDDIVIIAGKGHENYQILKDKTIHF
DDKEVAREAVAAREKSYAMHFSLADIERAAKAEVVRTAADIAFSDIVTDTRKIAAGSLFV
ALQGERFDGADFAAQAVEKGAAGVLVAVDTPEAKLPKTGVVLKAKDTLLAYQQIAAAWRR
KFSIPVVAITGSNGKTTTKDLTAAVLGACLLVQKTAANYNNEIGLPLTLLGLRAAHEAAV
VEIGMRGLGQIAALAPLAAPTVAIVTNVGEVHMELLGSIENIARAKAELVEAVEPGGTVI
LNADDARVLAMREKAKAGVRVVTFGLSRDADVRAVAVGKAEGGMRFMLEWKNERGRLERH
ELFLPMPGRHNVSNALAAIAAARVLGLSLADVRRGLAVPPAQKMRFAVEKCGAYTFVNDA
YNASPVSTRASLKTLAEMFAGRKIAVLGDMLELGSASKSGHASVGEEAAHLGFAAVLSRG
EESRFIAEAAKAGGVPLVERMTSHEAAAARLKEILQPGDAVLFKGSRGMKMDEIIPLLKK
ALEAGK
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcttgccgagttggcggcgctcgtcgagggcgctgaaatcaagggagatgca
gctgcgaagatcgcggacatcgtgcacgattcgcgcgaggtgacggaggggacgctcttc
gtcgccatcgaggggctgcatgtcgacggccattccttcatcgcgcaggcggtcgagaag
ggcgcgtgcgcgattctgacggagcgtgagatcgagattcccgagggtgcggcggcagtt
cttcgcgtgccaaatcttgcggcggcgcttgaggtcatcgtgccgtttttccatgactac
ccgtcgcgaaagatgcgcatcatcggcatcacgggcacgaacggcaagacgacgacgagc
tacatgacgcgtgccatcctgcgcgaggcggggtacaaggtcgggctcatcggcacgatt
cagatcctcgtcgaggatgaggctctgccgattcacaatacgacgcccgacgtcgtcgtc
ctggaacgaacgctcgcctatatggcgcggcgcggcatggatttcgtcgtcatggaggtt
tcttcgcatgcgctcgatcagaaccgcgtggcgggcatcgaattcgatacggcggtattc
acgaacctcacgcaggatcatctcgactaccataagacgctcgaaaactacaagcgcgcg
aaagcgcgccttttcgaccttgtgagccgcaagggcgcgaaggagggcaagacagccgtc
gtcaatgatgacgatgcggcgggcgaaacgatgctcgcccatgcgaagtgtgcgcatctc
acgtatgccgtgaagaaggaagccgcccttcgcgccgagaacatccgcgtccatgcgcgg
ggcctggagctgacgcttgcaggcgctttcggcaggatggatctttcgctcggcgtcacg
ggaatcttcaatgtctacaacgtcatgagcgccgtcggcgcggcgctcgcggaaaggatc
gcgcccgaggcgatcaagagggcgctcgaagctttcaagagcgtgcccgggcgttttgag
ctcgtcgatgcggggcaggcgttctccatcatcgtcgactatgcgcatacgcccgacggc
ttggagaacatcctgaatacggcgcgtgagattgcggcgggacgcatcctcacggtgttc
ggctgcggcggcgaccgcgaccgcacgaagcggccgatcatggggcgcatcgcggcggcg
ctttccgatgtcgtgctcgtgacctcggacaatccgcgcacggaagatcccgcgcgcatc
ctcgatgaggtcgaggtcggtgtgcttgagaagatcggcgacaagtgccatgaaaaaatc
gccgaccgccgcacggcgatcgtgcgagccgtggcgctcgccgaaaaggacgacatcgtc
atcatcgcaggcaaggggcacgagaattaccagatcttgaaggacaagacgatccacttc
gacgacaaggaagtcgcacgcgaggccgtcgccgcgcgggaaaaaagctatgcgatgcac
ttttcgctcgccgacatcgagcgtgcggcaaaggccgaagtcgtgcgcacggcggcggac
atcgcattttccgacatcgtgacggatacgcgaaagattgcggcgggatcgctcttcgtc
gcgcttcaaggcgagcgctttgacggcgcggactttgcggcgcaggcggtcgaaaagggc
gcggcgggcgtgctcgtagcggttgatacgcccgaggcgaagctgccgaagacgggcgtc
gtgctcaaggcgaaggacaccctgctcgcctatcagcagatcgccgccgcgtggcgcagg
aagttttcgatccccgtcgtcgccatcacgggatcgaacggcaagacgacgaccaaagac
ttgacggccgccgtgctcggcgcatgccttcttgtgcagaagacggcggcgaactacaac
aacgagatcggcctgccgctgacgctccttggccttcgcgccgcgcacgaggcggctgtc
gtcgagatcggcatgagaggactcgggcagatcgccgcgctcgcgccgctcgccgcaccg
accgtcgccatcgtgacgaatgtcggcgaggtgcacatggagcttctcggctcgatcgaa
aacatcgcgagggcgaaggcggagcttgtcgaggctgtggagccgggcggcacggtcata
ctgaacgccgacgatgcgcgcgtcctagcgatgcgcgagaaggcgaaggcgggcgtgcgc
gtcgtgaccttcgggctttctcgcgatgccgatgtgcgtgccgtcgccgtcggcaaggcc
gagggcggcatgagattcatgctggaatggaaaaacgagcgcgggcgactggaacggcac
gagctcttcctgccgatgccagggagacacaatgtgtcgaatgcgctcgccgccatcgct
gcggcccgcgtgctcggcctttcgctcgcggatgtccggcgcggactcgccgtgccgcct
gcgcagaagatgcgcttcgccgtcgagaagtgcggcgcatacaccttcgtcaacgacgct
tacaatgcgagtcccgtatcgacacgcgcgtccttgaagacgctcgccgagatgttcgcg
ggcaggaagatcgccgtcctcggcgacatgctcgaactcggcagcgcgtcgaagagcggc
cacgcgagcgtgggcgaggaggcggcgcatcttggctttgccgccgtcctctcgcgcggc
gaggagagccgcttcatcgcagaggccgcaaaggcgggcggcgtgccgctcgtcgagcgc
atgacgtcgcatgaagcggcggcggcaaggctcaaagagatcctgcagccgggcgacgcc
gtgctcttcaaaggatcgcgcggcatgaagatggatgagatcatccccctgttgaagaag
gcgctggaggcaggcaaatga

DBGET integrated database retrieval system