KEGG   Selenomonas sputigena: Selsp_1874Help
Entry
Selsp_1874        CDS       T01474                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssg  Selenomonas sputigena
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Selsp_1874
  Lipid metabolism
   00561 Glycerolipid metabolism
    Selsp_1874
   00600 Sphingolipid metabolism
    Selsp_1874
Enzymes [BR:ssg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Selsp_1874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2061643..2063868)
Genome map
AA seq 741 aa AA seqDB search
MNIVYHEQGRVFHLFNDSVSYIFMVLPHGGLGSLYYGKALRDREGFEHIFERAHRGMTAC
VFADTRSYSLDAIRQELPTYGSSDFRRPALNVLQENGSRILDLQYAGYRVMDGKPKLAGL
PATYTEAETEAKTLIVEVKDELTGLRAELLYTIFAEGGAIARSVRYINEGKEVLHLQKVM
SMSIDLPDTEYDWLELTGAWSRERHIEIRPLATGITAIGSRRGHSSGQYNPFAALLRRGT
TETCGEALAMSLVYSGNFEMLAEVDNHGVTRLQAGIHSTDFDWKLMPGAEFQTPEAVLVW
TDAGLNGMSQTYHRLYQKRLARGPWRDKVRPILINNWEATYFDFTEEKLLKIADKAAECG
IELFVLDDGWFGARTSDYAGLGDWTVNRDRLPNGIDGLAEKIEARGMKFGIWVELEMVNE
DSDLYRAHPDWVLSVPGRRKSLGRSQCVLDFSRQEVVDNIYGQVEAILASGKVSYVKWDM
NRSITECWSHALPADQQGEVFHRYILGLYELYERLTAKFPHVLFESCASGGGRFDPGMLY
YAPQAWTSDNSDAAERQKIQYGTSMCYPVSSMGSHVSVVPNHQMNRMTPLHTRANTAYFG
TFGYELDLNKLTEEEIAEVKEQVSFMKEYREIFQYGTFYRLQSPFENNVMAWMSVSADRK
TAIVGWYRTLNRVNYRFERVKLAGLLPDVLYENRRNGVRCYGDELMNYGLITTDGTAGEP
IAENGLTVDFESRIYVLKAVE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtttatcatgagcagggcagggtctttcatctcttcaacgattccgtgagt
tacatcttcatggtgctgccccatggcgggctgggttcgctctattatggcaaggcgctt
cgcgaccgtgaggggtttgagcacatcttcgagcgtgcgcaccgcggcatgacggcatgt
gtctttgcggatacgcgcagctactcgctggacgcgatccgccaggaattgccgacgtac
ggctcgtcggattttcgccgccctgcgctgaatgttcttcaggaaaacggcagccgtatc
ctcgatctgcagtatgcaggctatcgcgtcatggacggcaagccgaaactcgcagggctg
cccgcgacatatacggaggcggagacggaggcaaagacgctcatcgtcgaggtgaaggac
gaattgacgggactgcgtgccgagcttctctataccatatttgccgagggcggtgccatc
gcgcgcagtgtgcgttacatcaatgagggcaaggaagtgctgcatttgcagaaggtcatg
agcatgtcgattgacttgcccgatacggagtacgattggctggaactgacgggggcttgg
tcacgcgagcgtcatattgagattcgtccgctcgcaacgggcatcacggcgattggcagc
cgccgcgggcactcttcgggacagtacaatccttttgcagcgctcctgcgtcgcgggacg
acggagacatgcggtgaggcgctggcgatgagcctcgtctacagcgggaatttcgagatg
cttgccgaggtcgacaaccacggtgtgacacgtctgcaggcgggtattcacagcacggat
ttcgactggaagcttatgccgggcgcagagttccagacgcccgaggcggttctcgtctgg
acggatgcgggactcaacggcatgagtcagacgtatcaccgtctctatcagaagcgattg
gcgcgcggaccgtggcgcgacaaggtgcgcccgattctcatcaacaactgggaagcgacg
tattttgactttacggaagagaagctgctcaagatagcggacaaggcggcggagtgcggc
atcgagctcttcgttctcgacgacggctggttcggtgcgcgcacctccgactatgcggga
ctgggcgactggacggtaaaccgcgaccgtttgccgaacggcatcgacggacttgcggag
aagatcgaggcgcgcggcatgaagttcggcatctgggtcgagcttgagatggtcaacgag
gactccgatctctatcgtgcgcatcccgactgggtgctttccgtaccgggacggcgcaag
tcgctcggacgctcgcagtgcgtgctcgatttctcgcgccaagaggtggtcgacaacatc
tatgggcaggtggaggcgattctcgcgagcggcaaggtctcctatgtgaaatgggacatg
aaccgcagcatcacggaatgctggtcgcatgcgctgcctgccgatcagcagggcgaggtg
ttccatcgctatatcctcggcctttacgagctctacgaacgcctgaccgcgaagttcccg
catgtgctcttcgagtcctgcgcttcgggcggcggccgctttgaccccggtatgctttac
tatgcgccgcaggcgtggacgagcgacaattcggatgccgccgagcggcaaaagatccag
tacggcacatccatgtgctatcctgtgagcagcatgggcagccatgtctccgtcgtgccg
aaccatcagatgaaccgcatgacgccgctgcacacgcgtgcgaatacggcatacttcgga
acgttcggctatgagctcgatttgaacaaattgacggaagaggagattgcagaggtcaaa
gaacaggtttcctttatgaaggagtatcgggaaatcttccagtacgggacgttctatcgc
ctgcaaagcccctttgaaaataatgtcatggcgtggatgagcgtgagtgcggatcggaag
acggcgattgtcggatggtatcgcacactgaaccgcgtgaattatcgcttcgagcgcgtg
aagcttgcgggactcctgccggatgtcctctatgaaaatcgccgcaacggtgtgcgctgc
tacggcgacgagctgatgaactacgggcttatcacgacggacggcacggcgggcgaaccg
attgcggagaacggattgacggtggattttgagtcgcgcatttatgtgctgaaggctgtt
gaataa

DBGET integrated database retrieval system