KEGG   Selenomonas sputigena: Selsp_1879Help
Entry
Selsp_1879        CDS       T01474                                 

Definition
glycoside hydrolase family 2 TIM barrel
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ssg  Selenomonas sputigena
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssg00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssg00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ssg00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2068837..2071962)
Genome map
AA seq 1041 aa AA seqDB search
MAAFDFEKLKDPCYFAENRLPAHSDHVFYRDEAELARGVSSFYRTLGGIWHFAYARNTEH
IPQGFEAADYDCRDWETIRVPAHIQMEGHGAPHYTNTTYPWDGHESIVPGEIPVRDNPVG
CYVKYFAVPEDWERVYISFGGVDAAFALFLNGHFVGYSEDSCTPADFDLTPYLVAGENKL
AAMVFRYTSASWLEDQDFWRFSGIYRDVLLYTKPQHHIEDVAVRAVPLERDGYTHGKLDV
RLAFNDASEKHVEILLCDSEGDCVEGEEAVVTATTHACSMEAACVLLWSAEHPWLYHLMI
RVHDAAGALQEVVRVRVGFREFCIRDGVMQINGERIVFKGVNRHEFDSDHGRAMDPALFE
QDIIALKRANVNAIRTSHYPNSSRLYELADIYGFYVIDETNLETHGSWMKNGACAKDAHT
VPGDSEEWLPAVLDRAQSMYERDKNHPCILIWSCGNESCGGRTIYEMSEHFRRVDSTRLV
HYEGIFWDRSYPATSDMESQMYTKAADIEAFLKEHRDKPFICCEYTHAMGNSCGGMHKYT
ELTEREPLYQGGFIWDFGDQAIRRRGRYGEDVFLYGGDFGDRPSDYNFSGNGIFFADRRP
TAKLQEVKYNYQNFTLRPSWNGVEIENKSLFSDADDYELRLTLLLDGRKIWETWQQGHHV
EPGETKFIDTAIYKMPYLGAGEYVLTASLCLKNEEPWAPAGYEIAFGQAVVVPPENTGAS
LFDILGCGVAAPAYAALEASGSLRVVQGDINLGVQGAGFSLMFSSAQGNLVSYRHGGREL
IEELPQPSFWRAPIDNDYGSGRMADTAQWKLASLYRRCTRIEYSVDGEDFETVNGFFGRR
DERRAKRVIVRFTYAFATEPAAACVVSYTAEASGEVGVTMEYETAGMPEMPDFAMIFTLD
ADYDRIRFYGYGPKENYIDRCCGARLGVYESTAADEVEPYLRPQETGNHCGVRWIEVTDH
GGHGIRLAADVPFEASALPYSPHELENARHAYDLPRPQHTYLRASAGMCGVGGDDSWGAP
VLAEYTYPNGKRSLSFKMKGI
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggctgcattcgactttgagaaattgaaagatccgtgctacttcgcagagaaccgtctg
cctgcgcacagcgaccacgtcttctatcgcgacgaagcggagcttgcgcgcggcgtgtcc
tcattttaccgtacgctcggcggcatttggcatttcgcttatgcgcggaacaccgagcac
atcccgcaggggttcgaggcggcggattacgactgccgcgattgggagacgatccgtgtg
ccggcgcatatccagatggaggggcacggagcgccgcattacacgaatacgacgtacccg
tgggacgggcatgagagcatcgtgccgggcgagattcctgtgcgcgataatcccgtcggc
tgctatgtgaagtattttgccgtgcccgaggattgggagcgcgtctatatctcctttggc
ggcgtggatgcggcgttcgcactctttctcaacggtcatttcgtcggctacagtgaggac
agctgcacgcctgcagacttcgacctgacgccgtatctcgtggcgggggagaacaagctg
gcggcgatggtattccgctatacgagtgcgagctggcttgaggatcaggacttctggcgg
ttctcgggaatctatcgcgacgtcctgctctacacgaaaccgcagcatcacatcgaggat
gttgccgttcgtgccgtgccgcttgagcgggatggctatacgcacggaaagcttgatgtg
cgtcttgcgttcaacgatgcgtcagaaaagcatgtcgagatcctgctctgcgattcggaa
ggagattgtgtagagggggaagaggcggtcgtcacggcaacgacccatgcgtgctcgatg
gaggctgcctgcgtgcttctttggagcgcggagcatccatggctctaccatcttatgatc
cgcgtgcatgatgcggcgggtgctttgcaggaggtcgtgcgcgtgcgcgtcggtttccgt
gagttctgcatccgggacggagtcatgcagatcaacggcgagcgcatcgtgttcaaggga
gtcaatcgtcacgagtttgactctgaccatgggagggcgatggatcccgcgctcttcgag
caggatatcatcgcactcaaacgtgcgaatgtcaacgcgattcgcacgtcgcactatccg
aacagcagtcgtctctacgagctggcagacatttatggcttttatgtgatcgatgagacg
aatcttgagacgcacggctcatggatgaagaacggggcgtgtgcgaaggacgcgcatacc
gttcccggcgacagcgaggagtggctgcccgccgtgctcgaccgcgcgcagtcgatgtac
gagcgcgacaagaatcatccgtgcatcctcatttggtcgtgcggcaacgagtcctgcggc
ggccgcacgatctacgagatgagcgagcacttccgccgcgtcgattccacgcgcctcgtg
cattacgaggggattttctgggaccgcagctatccggcgacgagcgatatggagagtcag
atgtatacgaaggcggcggacatcgaagcgttcctcaaggagcaccgcgacaagccgttc
atttgctgcgagtatacacacgctatgggcaacagctgcggcggcatgcacaagtacacg
gagctgacggagcgcgagcctctgtatcagggcggattcatctgggatttcggcgatcag
gcaatccgtcggcgcggacgctatggggaggatgtattcctctacggcggcgacttcggc
gatcgtccgtcggactacaacttcagcggcaacggcatcttctttgccgatcgtcgtccg
acggcaaagctgcaggaagtgaagtacaactatcagaatttcacgctccgtccttcgtgg
aacggtgtggagatcgagaataagagtcttttctccgatgcggatgactatgaattgcgg
ctgacgctcctccttgacggacgaaaaatctgggagacttggcagcagggacatcatgtg
gagcctggggaaactaaattcattgatacggcgatctacaaaatgccgtatcttggcgcg
ggggagtacgtgctgacggcatcgctctgcctgaagaatgaggaaccgtgggcacctgcc
ggctacgagatcgccttcggacaggccgttgttgtgccgcccgagaatacaggagcaagt
ctcttcgacatcctcggctgcggtgtcgctgctcccgcctatgcagcacttgaggcgtcg
ggcagtctgcgcgtggtgcagggggacatcaatctcggcgtgcagggggcgggcttctcc
cttatgttctcaagtgcgcagggcaatctcgtctcctatcgccatggcggacgtgagctg
atcgaggagctgccgcagccgagcttctggcgtgcgccgatcgacaatgactacggcagc
ggacgcatggcggatacggcgcagtggaaactcgcgagcctctatcgtcgctgcacgcgc
atcgagtacagcgtggacggcgaagatttcgagacggtgaacggtttcttcggcagacgc
gatgagcggcgcgccaagcgcgtcatcgtgcgctttacttatgcgtttgccacggagcct
gctgctgcgtgtgtggtctcctatacggcggaggcaagcggggaagttggcgtcacgatg
gagtatgagacggcggggatgcccgagatgcccgactttgccatgatctttacgctagat
gcggactatgaccgcattcgcttctatggctacgggccgaaggaaaactacatcgaccgc
tgctgcggcgcacgtctcggcgtctacgagagcacggcggcggacgaggtcgagccgtat
ctgcgtccgcaggagacgggcaatcactgcggcgtgcgctggatcgaggtcacggatcat
ggcggtcacggaatccgtctcgcggcagatgtgccgtttgaggcatcggcgctcccgtac
agtccgcacgagctggagaatgcgcgccatgcgtatgatttgccgcgtccgcagcataca
tatctgcgtgcgtcggcaggcatgtgcggcgtgggcggcgacgacagctggggtgcaccc
gtgcttgcggagtatacctatccgaatgggaagagaagcctctcgtttaagatgaagggg
atttga

DBGET integrated database retrieval system