KEGG   Selenomonas sputigena: Selsp_1920Help
Entry
Selsp_1920        CDS       T01474                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssg  Selenomonas sputigena
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Selsp_1920
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Selsp_1920
Exosome [BR:ssg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Selsp_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2116784..2118286
Genome map
AA seq 500 aa AA seqDB search
MGQKYVMALDAGTTSNRAIIFDADSKIVGVAQKEFTQHFPQPGWVEHDAEEIWSSMHEVM
REALEQSGLVASDIAAIGITNQRETTVIWDRTTGRPIYNAIVWQSRQTADICEDLKRQGL
VDEFKEKTGLVIDAYFSGTKVKWILDHVEGARARAEKGELAFGTIDTWLLWKLTGGKEHK
TDYSNASRTLMFNIKTLEWDEALLKHLTVPKSLLPEVRPSSEVYGHTVPSVIGASVPVAG
MAGDQQSALFGQNCFSPGEAKNTYGTGCFLLMNTGTDICMSKNGLVTTIAWGLDGKVEYA
LEGSIFVGGSAIQWLRDGLRLVDSAPDSEWVAKKVPDAGGVYMVPAFVGLGAPYWDMNAR
GMIIGLTRGTTKAHIVRATLDSLAYQTRDVLGSMEADSGNRLAALKVDGGAVANNLLMQF
QADLLGVPVDRPQITETTALGAAYLAGLATGVWASKEDLKKSWQLDTRFTPALDKKDADK
LYKGWKKAVKHAANWLADEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaaatacgtcatggcgcttgacgccggcacgacgagcaaccgcgccatcatc
ttcgatgcagattccaagatcgtcggcgtcgcgcagaaggagttcacgcagcacttcccg
cagcccggctgggttgagcacgacgcggaagagatctggagctccatgcacgaggtcatg
agggaagctctcgaacagtcgggactcgtcgcgagcgacatcgccgccatcggcatcacg
aaccaacgcgagacgacggtcatctgggatcggacgacggggcggccgatctacaacgcc
atcgtctggcagtcgcgccagacggcggacatctgcgaggacttgaagcgtcagggtctt
gtcgatgagttcaaggagaagacgggactcgtcatcgacgcctacttctcgggcacgaag
gtcaagtggattctcgaccatgtggaaggcgcacgcgcacgcgcggaaaaaggcgagctt
gccttcggcacgatcgacacttggctcctgtggaagctcacgggcggcaaagagcacaag
acggactactccaacgcatcgcgcaccctgatgttcaacatcaagacgctcgaatgggac
gaggcgctcttgaagcatctgaccgtgccgaagagcctgctgcccgaggtgcgtccgtcg
agcgaggtctacggtcacaccgtcccctcggtcatcggcgcttccgttcccgtcgcgggc
atggcgggcgaccagcagtcggcgctcttcggacagaactgcttctcccccggcgaagcg
aagaacacttacggcacgggctgcttcctgctcatgaacacgggcacggatatatgcatg
tcgaagaacggactcgtgacgactatcgcctggggacttgacggcaaggtcgaatacgcg
ctcgaaggctcgatcttcgtcggcggctccgccatccaatggctgcgcgacggcctgcgt
ctcgtcgactccgctcccgactccgaatgggtcgcgaaaaaagttcccgatgccggcggc
gtctacatggtgcccgccttcgtcggactcggcgcaccgtattgggatatgaacgcgcgc
ggcatgatcatcggcctcacgcgcggcacgacgaaagcgcacatcgtacgcgccacgctc
gactccctcgcctaccagacgcgcgacgtgctcggctcgatggaagccgactcgggcaac
cgcctcgctgcgcttaaggtcgacggcggcgccgtcgccaacaacctcctcatgcagttc
caagccgacctcctcggcgttcccgtcgaccgcccgcagatcacggagacgacggctctg
ggcgccgcctacctcgccggtcttgccacgggcgtctgggcgtcgaaggaagatctcaag
aagagctggcagctcgacacgcgctttacgcccgccctcgacaagaaggatgcggacaag
ctctacaagggctggaagaaggccgtcaagcacgccgcgaactggctcgcggatgaagaa
tag

DBGET integrated database retrieval system