KEGG   Selenomonas sputigena: Selsp_1956Help
Entry
Selsp_1956        CDS       T01474                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssg  Selenomonas sputigena
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ssg00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssg00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssg00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2161928..2162836)
Genome map
AA seq 302 aa AA seqDB search
MMAKQKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDTPAIQFIVEEAIASGIEEILIIT
GRNKRSIEDHFDRSLELEMQLKEHGKYDMLKMVEEISDIQIHFIRQKEARGLGHAVLCAR
QFVGDEPFAVLLGDDLVDAKVPCLAQLIDVYEDYGDSVLGVQQVPQSQVSRYGIVATHKV
KPNVWQAVDLVEKPEAEKAPSRLAVLGRYVLTPAIFDILEHTKPGAGEEIQLTDAICELA
RKEKVYAYRFEGRRYDIGDKEGFLEATVEQALKRPEIRDDFMAYLVQRIGPLLRQKMEED
AE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaagcagaaaatccgcaaggcgatcattcctgcagcgggactcggcacgcgt
ttcttgccggcgacgaaggcgcagccgaaggagatgctgcccatcgtcgatacgccggcc
atccagttcatcgtcgaggaggccatcgcctcgggcattgaggaaatcttgatcatcacg
gggcgcaacaagcgctcgatcgaggatcactttgaccgctcgttggagcttgaaatgcag
ctcaaggagcacggcaagtatgacatgctcaagatggtcgaggagatctcggacatccag
attcacttcattcgccagaaggaggcgcgcggactcggccacgccgtgctctgcgcgcgc
cagttcgttggcgacgagcctttcgccgtgctcctcggtgacgatctcgtcgacgcgaag
gtgccgtgcctcgcgcagctcatcgacgtctatgaggattacggcgacagcgtgctcggc
gtgcagcaggtgccgcagagccaggtttcgcgctacggtattgtcgccacgcacaaggtg
aagccgaatgtttggcaggcggtcgatctcgtggaaaaacccgaggcagaaaaggcaccg
tcgcgtctcgccgtgctcggccgctatgtgctgacaccggccattttcgacatcttggag
catacgaaaccgggtgcgggagaggagatccagctgacggacgccatctgtgagcttgcg
cgcaaggaaaaggtctacgcctatcgttttgagggaaggcgctacgacatcggcgacaag
gaaggcttcttggaggcgacggtggagcaggcgctgaagcgtcccgagatccgcgacgac
ttcatggcgtatctcgtgcaacggatcgggcctttgctccgacaaaagatggaagaagat
gcggagtaa

DBGET integrated database retrieval system