KEGG   Selenomonas sputigena: Selsp_1956Help
Entry
Selsp_1956        CDS       T01474                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00040  Pentose and glucuronate interconversions
ssg00052  Galactose metabolism
ssg00500  Starch and sucrose metabolism
ssg00520  Amino sugar and nucleotide sugar metabolism
ssg01100  Metabolic pathways
ssg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Selsp_1956
   00052 Galactose metabolism
    Selsp_1956
   00500 Starch and sucrose metabolism
    Selsp_1956
   00520 Amino sugar and nucleotide sugar metabolism
    Selsp_1956
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Selsp_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEC00909
UniProt: C9LRH1
Position
complement(2161928..2162836)
Genome map
AA seq 302 aa AA seqDB search
MMAKQKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDTPAIQFIVEEAIASGIEEILIIT
GRNKRSIEDHFDRSLELEMQLKEHGKYDMLKMVEEISDIQIHFIRQKEARGLGHAVLCAR
QFVGDEPFAVLLGDDLVDAKVPCLAQLIDVYEDYGDSVLGVQQVPQSQVSRYGIVATHKV
KPNVWQAVDLVEKPEAEKAPSRLAVLGRYVLTPAIFDILEHTKPGAGEEIQLTDAICELA
RKEKVYAYRFEGRRYDIGDKEGFLEATVEQALKRPEIRDDFMAYLVQRIGPLLRQKMEED
AE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaagcagaaaatccgcaaggcgatcattcctgcagcgggactcggcacgcgt
ttcttgccggcgacgaaggcgcagccgaaggagatgctgcccatcgtcgatacgccggcc
atccagttcatcgtcgaggaggccatcgcctcgggcattgaggaaatcttgatcatcacg
gggcgcaacaagcgctcgatcgaggatcactttgaccgctcgttggagcttgaaatgcag
ctcaaggagcacggcaagtatgacatgctcaagatggtcgaggagatctcggacatccag
attcacttcattcgccagaaggaggcgcgcggactcggccacgccgtgctctgcgcgcgc
cagttcgttggcgacgagcctttcgccgtgctcctcggtgacgatctcgtcgacgcgaag
gtgccgtgcctcgcgcagctcatcgacgtctatgaggattacggcgacagcgtgctcggc
gtgcagcaggtgccgcagagccaggtttcgcgctacggtattgtcgccacgcacaaggtg
aagccgaatgtttggcaggcggtcgatctcgtggaaaaacccgaggcagaaaaggcaccg
tcgcgtctcgccgtgctcggccgctatgtgctgacaccggccattttcgacatcttggag
catacgaaaccgggtgcgggagaggagatccagctgacggacgccatctgtgagcttgcg
cgcaaggaaaaggtctacgcctatcgttttgagggaaggcgctacgacatcggcgacaag
gaaggcttcttggaggcgacggtggagcaggcgctgaagcgtcccgagatccgcgacgac
ttcatggcgtatctcgtgcaacggatcgggcctttgctccgacaaaagatggaagaagat
gcggagtaa

DBGET integrated database retrieval system