KEGG   Selenomonas sputigena: Selsp_1956Help
Entry
Selsp_1956        CDS       T01474                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssg  Selenomonas sputigena
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Selsp_1956
   00052 Galactose metabolism
    Selsp_1956
   00500 Starch and sucrose metabolism
    Selsp_1956
   00520 Amino sugar and nucleotide sugar metabolism
    Selsp_1956
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Selsp_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2161928..2162836)
Genome map
AA seq 302 aa AA seqDB search
MMAKQKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDTPAIQFIVEEAIASGIEEILIIT
GRNKRSIEDHFDRSLELEMQLKEHGKYDMLKMVEEISDIQIHFIRQKEARGLGHAVLCAR
QFVGDEPFAVLLGDDLVDAKVPCLAQLIDVYEDYGDSVLGVQQVPQSQVSRYGIVATHKV
KPNVWQAVDLVEKPEAEKAPSRLAVLGRYVLTPAIFDILEHTKPGAGEEIQLTDAICELA
RKEKVYAYRFEGRRYDIGDKEGFLEATVEQALKRPEIRDDFMAYLVQRIGPLLRQKMEED
AE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaagcagaaaatccgcaaggcgatcattcctgcagcgggactcggcacgcgt
ttcttgccggcgacgaaggcgcagccgaaggagatgctgcccatcgtcgatacgccggcc
atccagttcatcgtcgaggaggccatcgcctcgggcattgaggaaatcttgatcatcacg
gggcgcaacaagcgctcgatcgaggatcactttgaccgctcgttggagcttgaaatgcag
ctcaaggagcacggcaagtatgacatgctcaagatggtcgaggagatctcggacatccag
attcacttcattcgccagaaggaggcgcgcggactcggccacgccgtgctctgcgcgcgc
cagttcgttggcgacgagcctttcgccgtgctcctcggtgacgatctcgtcgacgcgaag
gtgccgtgcctcgcgcagctcatcgacgtctatgaggattacggcgacagcgtgctcggc
gtgcagcaggtgccgcagagccaggtttcgcgctacggtattgtcgccacgcacaaggtg
aagccgaatgtttggcaggcggtcgatctcgtggaaaaacccgaggcagaaaaggcaccg
tcgcgtctcgccgtgctcggccgctatgtgctgacaccggccattttcgacatcttggag
catacgaaaccgggtgcgggagaggagatccagctgacggacgccatctgtgagcttgcg
cgcaaggaaaaggtctacgcctatcgttttgagggaaggcgctacgacatcggcgacaag
gaaggcttcttggaggcgacggtggagcaggcgctgaagcgtcccgagatccgcgacgac
ttcatggcgtatctcgtgcaacggatcgggcctttgctccgacaaaagatggaagaagat
gcggagtaa

DBGET integrated database retrieval system