KEGG   Selenomonas sputigena: Selsp_1956Help
Entry
Selsp_1956        CDS       T01474                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssg  Selenomonas sputigena
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Selsp_1956
   00052 Galactose metabolism
    Selsp_1956
   00500 Starch and sucrose metabolism
    Selsp_1956
   00520 Amino sugar and nucleotide sugar metabolism
    Selsp_1956
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Selsp_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2161928..2162836)
Genome map
AA seq 302 aa AA seqDB search
MMAKQKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDTPAIQFIVEEAIASGIEEILIIT
GRNKRSIEDHFDRSLELEMQLKEHGKYDMLKMVEEISDIQIHFIRQKEARGLGHAVLCAR
QFVGDEPFAVLLGDDLVDAKVPCLAQLIDVYEDYGDSVLGVQQVPQSQVSRYGIVATHKV
KPNVWQAVDLVEKPEAEKAPSRLAVLGRYVLTPAIFDILEHTKPGAGEEIQLTDAICELA
RKEKVYAYRFEGRRYDIGDKEGFLEATVEQALKRPEIRDDFMAYLVQRIGPLLRQKMEED
AE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaagcagaaaatccgcaaggcgatcattcctgcagcgggactcggcacgcgt
ttcttgccggcgacgaaggcgcagccgaaggagatgctgcccatcgtcgatacgccggcc
atccagttcatcgtcgaggaggccatcgcctcgggcattgaggaaatcttgatcatcacg
gggcgcaacaagcgctcgatcgaggatcactttgaccgctcgttggagcttgaaatgcag
ctcaaggagcacggcaagtatgacatgctcaagatggtcgaggagatctcggacatccag
attcacttcattcgccagaaggaggcgcgcggactcggccacgccgtgctctgcgcgcgc
cagttcgttggcgacgagcctttcgccgtgctcctcggtgacgatctcgtcgacgcgaag
gtgccgtgcctcgcgcagctcatcgacgtctatgaggattacggcgacagcgtgctcggc
gtgcagcaggtgccgcagagccaggtttcgcgctacggtattgtcgccacgcacaaggtg
aagccgaatgtttggcaggcggtcgatctcgtggaaaaacccgaggcagaaaaggcaccg
tcgcgtctcgccgtgctcggccgctatgtgctgacaccggccattttcgacatcttggag
catacgaaaccgggtgcgggagaggagatccagctgacggacgccatctgtgagcttgcg
cgcaaggaaaaggtctacgcctatcgttttgagggaaggcgctacgacatcggcgacaag
gaaggcttcttggaggcgacggtggagcaggcgctgaagcgtcccgagatccgcgacgac
ttcatggcgtatctcgtgcaacggatcgggcctttgctccgacaaaagatggaagaagat
gcggagtaa

DBGET integrated database retrieval system