KEGG   Selenomonas sputigena: Selsp_1998Help
Entry
Selsp_1998        CDS       T01474                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ssg  Selenomonas sputigena
Pathway
ssg02020  Two-component system
ssg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Selsp_1998
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Selsp_1998
Enzymes [BR:ssg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Selsp_1998
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Selsp_1998
Two-component system [BR:ssg02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Selsp_1998
Bacterial motility proteins [BR:ssg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Selsp_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AEC00948
UniProt: C9LYT4
Position
2214390..2215061
Genome map
AA seq 223 aa AA seqDB search
MNERRRSDMESGKSDKRGKTSLFPVAMPPASTKEKQLIAIGASTGGTEAIAAILKNLAPP
LPPIVIVQHIPPIFSNHFAHRLNAISKLTVKEAEDGETIKDSTAYVAPGGQHMKLERRSG
RLVVTCTKGDPVNWVRPSADVLFFTVAELVGDAALGVILTGMGADGAKGLFAMRHAGAMT
FGQDEASCVVYGMPRAAFELGAVERQLPLAMMAGAITQAVRGR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaggaggagaagcgacatggaaagcggcaagagcgataagaggggcaagacg
agcctttttcctgtcgccatgcctccggcatcgacgaaggaaaagcagctgatcgccatc
ggcgcttcgacgggcggtacggaagcgatcgcggccatcctcaagaacctcgcgccgccg
ctccctcccatcgtcatcgtgcagcacatcccgcccatcttcagcaaccactttgcgcac
agactcaacgccatatcgaagctcacggtcaaggaagccgaggacggcgaaaccatcaag
gactcgaccgcctacgtcgcgcctggaggtcagcacatgaagctcgaaaggcgttcgggc
aggctcgtcgtcacatgcacgaagggcgatcccgtgaactgggtgcgcccgtccgccgac
gtcctcttcttcaccgtagcagaactcgtcggtgacgcagcgctcggcgtcatcctcaca
ggcatgggcgcggacggcgcgaagggactcttcgccatgcgccacgcgggcgccatgacg
ttcggtcaggacgaagcctcatgcgtcgtctacggcatgccgcgcgcggccttcgagctg
ggagcagtcgagcggcagctgccgctcgcgatgatggcgggcgcgatcacgcaggccgtg
cgcgggcgatag

DBGET integrated database retrieval system