KEGG   Selenomonas sputigena: Selsp_2025Help
Entry
Selsp_2025        CDS       T01474                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25 3.2.1.41)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssg  Selenomonas sputigena
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Selsp_2025
Enzymes [BR:ssg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Selsp_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2242541..2245990)
Genome map
AA seq 1149 aa AA seqDB search
MAQREAEHNSQDVFYRSPVGPAEASSSVQLGIRIRTQDEVSKVILRLWREGAGERLIELE
TKSAEGVQDRFYVARIDLPDTGCLLWYYFIVATSSGTWYYGNNNEHLGGMGGIYDNAPPS
FQITVFNKGAKTPDWAKHAVMYQIFPDRFCREGDAIVEKKGAVVHAHWGDQPCYYKDVDT
KEIVQYDFFGGNIKGLKSKLSYLRELGISVIYLNPVFESPSNHHYDTGDYHKIDPIFGTN
EEFQDLVKAAKAEGIRIVLDGVFSHTGSDSIYFNREGNYDSLGAFQSQESPYYSWYNFHK
YPYEYDSWWGFSTLPNVTETTPSYMDFVIRDENSVLHYWTKMGIGGWRLDVVDELPAKFT
QGFYRELKAMNPDAILIGEVWEDASNKISYGVPREYLCGQEIDSAMNYPFRKTVLDFLLN
YVDGRQAMRLLESLRENYPKENFYVMMNLIGSHDVERAITLLGEAPFYDGMPAIHQSRFK
LDAEHYKLGTDRLRLAALLQMTYPGMPCIYYGDEIGMQGFRDPYNRSPYAWENPDASVRD
WYKKLIRLRNEHTALQTGDLLPLAGEGNILAYARTIRSGTDEFGAPAKNEAFVVIINRSR
TQEEKVMLNVGDFLQGTLQEALEGEERVQVQRGVLTVKLPPLSARIYEAVQEERRFPREA
GVLLHPTSLPSKYGIGDLGGDAYRFVDFLAAAGQKVWQVLPLCPVSDFGYSPYQSPSAFA
GNPMLISLDMLIDDGLLAARDVKAAADSATAFIDYERAWAFKKKHLERAWKNFQKQGESD
AFRDFCDKEAAWLDDYALFEALKAENKKAPWFEWKPELKERQNAALRAARERLADEIGCQ
KFWQYLFDKEWKHLHDYARKKGVKVMGDMPIFVSHDSVDVWANQGLFSLNEDGTAKTVAG
VPPDYFSATGQLWGNPQYDWTAMKEDGYGWWKARFRKLCSLVDIVRLDHFRGFEAYWEID
GKAKTAVNGCWRKGPGKAFFEEMEKSVENLSIVAEDLGIITDEVEKLRDDCGYPGMKVLH
FCLNFNEMRRVGIAVPENSIVYTGTHDNNTTVGWFTQDLDAPERAAVAELLNAHADRPKD
ICDKLVEFAYASNARLVIVPMQDVRALDSRSRMNVPGTVGINWRWRLKDFAHAEEDAKRL
RGLCELYER
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgagaagcggagcacaactcgcaagatgtgttttaccgctcgcccgtggga
cccgccgaggcatcatcctccgtccaactcggcattcgcatccgaacgcaggacgaagta
tcgaaggtcattctgcgcctttggcgagaaggcgcgggggaaaggctcatcgagctggag
acgaagtcggcggaaggcgtccaggaccgcttttatgtcgcgcgcatcgatttgcccgat
accggctgcctgctatggtactatttcatcgttgccacgagttccggcacatggtattac
ggcaacaacaacgagcatctgggcggcatgggcggcatttacgacaacgcaccgccgtcg
ttccagatcaccgtgttcaacaagggcgcgaagacccctgactgggcgaagcatgccgtc
atgtaccagatcttccccgatcgcttctgccgcgagggcgatgcgatcgtcgagaagaag
ggcgccgtcgtgcacgcgcactggggcgaccagccctgctactacaaggatgtcgatacc
aaggaaatcgtgcagtacgatttcttcggcggcaatatcaaggggctgaagtcgaagctt
tcctacctgagggagcttggcatttccgtcatctacctcaatcccgttttcgagtcgccg
agcaaccaccactacgatacgggcgactaccacaagatcgatccgatcttcggcacgaac
gaggagtttcaagacctcgtgaaggcggcgaaggccgagggcatccgcatcgtcctcgac
ggcgtattcagccatacgggaagcgacagcatctacttcaaccgcgagggcaattacgat
agcttaggcgcgttccagtcgcaggagtcgccctattacagctggtacaacttccataag
tatccttacgaatacgacagctggtggggattttccacgctgccgaacgtgacggagacg
acgccttcctacatggacttcgtgatccgcgacgagaacagcgtgctgcattactggacg
aagatgggcatcggcggctggcgtctcgatgtcgtcgacgaactgcccgcgaagttcacg
caaggcttctaccgcgaactcaaggcgatgaatcccgatgcgattctcatcggcgaggtc
tgggaggacgcgtcgaacaagatcagctacggcgtgccgcgcgagtacctctgcgggcag
gaaatcgactcggcgatgaactatccattccgcaagacggtcttggacttcctgctcaac
tacgttgacggacgccaggcgatgcgccttctggagagcctccgagagaattacccgaag
gaaaatttctacgtgatgatgaacctcatcggcagccacgacgtcgagcgagcgatcacg
ctcttgggcgaggcgccgttctacgacggcatgccggcgatccatcagtcgcgcttcaaa
ctcgacgccgagcactacaaactcggcacggatcggctgcgcctcgcggcgcttctgcag
atgacgtatccgggaatgccgtgcatctactacggcgatgagatcggcatgcagggattc
cgcgacccgtacaaccgcagcccgtacgcatgggagaatccggatgcctccgtgcgcgac
tggtacaagaagctcatacgcctgcgaaacgagcatacggcgcttcaaacgggcgacctc
ctgccgctcgcgggcgagggcaacattctcgcctatgcgcgcacgatccgaagcggcacg
gacgagttcggcgcacccgcgaagaacgaggccttcgtcgtcatcatcaaccgcagtcgt
acgcaggaggagaaggtcatgctcaatgtcggcgatttcctgcagggaacattgcaggaa
gctctcgaaggggaggaacgcgtgcaggttcagcgcggcgtcctgaccgtgaagctcccg
cccctttcggcgcgcatctacgaggccgtgcaggaggagaggcgcttcccgcgcgaagcg
ggcgtcctgcttcatccgacatccctgccgtcaaagtacggcatcggcgatcttggcggc
gacgcttatcgcttcgtcgatttcctcgccgccgccgggcagaaggtctggcaggttctg
ccgctgtgccccgtcagcgatttcggctattcgccttatcaatcgccgtcggcgttcgcg
ggcaatcccatgctcatttcgctcgacatgctcatcgacgacggactgctcgcggcgcgt
gacgtgaaggcggcggccgacagtgcgaccgctttcatcgattatgagcgggcatgggcg
ttcaagaagaagcatttggagcgtgcgtggaagaacttccagaaacagggagaaagcgac
gctttccgggatttctgcgataaggaggcagcctggcttgacgactacgcgctcttcgag
gccttgaaggctgagaacaagaaagcgccgtggttcgagtggaagccagagctgaaggag
cgacagaacgctgcgcttcgtgcggcgcgagagcgcctggcggacgagatcggctgccag
aagttctggcagtatctgtttgacaaagagtggaaacacctgcacgactacgcgcgaaag
aagggcgtcaaagtcatgggcgacatgcccatcttcgtctcgcacgacagtgtcgacgtc
tgggcgaaccaaggcttgttctcgctcaacgaggacggcacggcgaagacggtcgcgggc
gtgccgcccgactacttcagcgcgacgggacagctgtggggcaacccgcagtacgactgg
acggcgatgaaggaggacggctacggctggtggaaggctcgcttccggaagctttgctcg
ctcgtcgacatcgtgcgcctcgatcacttccgcggcttcgaggcgtattgggagatcgac
ggcaaggcgaagacggcggtcaacggctgctggcgcaaggggcctggcaaggcattcttc
gaagagatggagaagtcggtcgagaatctttccatcgtcgccgaagatcttggcatcatc
accgacgaagtcgaaaaactgcgcgacgactgcggctatccgggcatgaaggttctgcac
ttctgcctgaacttcaacgagatgcgccgcgtcggaatcgccgtgcccgaaaactccatc
gtctacacgggcacgcacgacaacaatacgacggtcggctggttcacgcaggatctcgac
gcccccgagcgggcggcggtcgcggagcttttgaacgcacacgccgaccggccgaaggac
atctgcgataagctcgtcgagttcgcctatgcgtcgaacgcgcgtctcgtcatcgtcccc
atgcaggatgtacgcgccctcgacagccgcagccgtatgaacgtgcccggcaccgtcggc
atcaactggcgctggcggctcaaggacttcgcacatgccgaagaggacgcgaagcgcctt
aggggcttgtgcgagctgtacgaaaggtag

DBGET integrated database retrieval system